(data stored in ACNUC7421 zone)

EMBL: CP000031.PE182

CP000031.PE182       Location/Qualifiers
FT   CDS_pept        complement(203121..204098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0186"
FT                   /product="bordetella uptake gene family protein"
FT                   /note="identified by match to protein family HMM PF03401"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0186"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93512"
FT                   /db_xref="GOA:Q5LWY4"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWY4"
FT                   /protein_id="AAV93512.1"
FT                   /translation="MKTNLTRRVMMAAASAAFAFSTPSWAEPVVDSIHFLIPGGAGGGW
FT                   DGTARGTGEALTAAGLAGTASYENMSGGGGGKAIGYLIENAASNHGTLMVNSTPIIIRS
FT                   LTGVFPQNFRDLTLVAGTIGDYAAIVVGKDSPVNSMTDLLASFDADPSGTAIGGGSVPG
FT                   GMDHLVAAMVMEAAGKDSLAVKYIAYDAGGKAMAALLSGEIAALSTGFSEAVDLANAGE
FT                   VKIIGVTSDDRVAAYPDAPTMKEQGIDTTFVNWRGFFGAPGLPEDRLAAYQEAIAKMYD
FT                   TPEWEAVRARNGWVNIHNSGDDFRAFLEKQEQQIGDLMRKLGFL"
     atgaaaacga acctgacccg ccgggtcatg atggccgccg cgtcggcggc atttgccttt        60
     tccacgccgt cctgggcaga accggtcgtg gacagcattc atttcctgat cccaggcggc       120
     gccggcggcg gctgggacgg caccgcgcgc ggcaccggag aggcgctgac cgcggcgggc       180
     ctggcgggca ccgccagtta cgagaacatg tcaggcggcg gtggcggcaa ggcgatcggc       240
     tatctgatcg aaaacgccgc ctcgaaccat ggcacgttga tggtcaattc gaccccgatc       300
     atcatccgct cactgaccgg tgtctttccg cagaacttcc gcgatctgac cctggtggct       360
     ggcacgatcg gagattacgc cgccattgtg gttggcaagg acagcccggt aaactcgatg       420
     accgaccttt tggcctcctt tgacgccgat ccaagcggca ctgccatcgg tggcggctcg       480
     gtacccggcg gcatggacca tctggtcgcc gcaatggtga tggaggccgc gggcaaggac       540
     tcgctggcgg tgaaatacat cgcctatgat gcgggcggca aggcgatggc cgcgctgctc       600
     tcgggcgaaa tcgcggcgct gagcaccggc ttctccgagg cggtggatct ggccaatgcc       660
     ggtgaggtca agatcatcgg cgtcacctcg gacgaccggg tcgccgccta tcccgatgca       720
     ccaacgatga aggagcaggg catcgacacc accttcgtca actggcgtgg cttctttggc       780
     gccccgggcc tgccggaaga ccggcttgcc gcctatcagg aggcgatcgc caagatgtat       840
     gacacgccag aatgggaagc cgtgcgcgcc cgtaacggct gggtcaatat ccacaacagc       900
     ggtgacgatt tccgtgcatt cctggagaag caggagcagc agatcggcga cctgatgcgc       960
     aagctgggtt tcctgtaa                                                     978
//

If you have problems or comments...

PBIL Back to PBIL home page