(data stored in ACNUC9435 zone)

EMBL: CP000031.PE183

CP000031.PE183       Location/Qualifiers
FT   CDS_pept        204208..204873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0187"
FT                   /product="DNA-binding response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0187"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93513"
FT                   /db_xref="GOA:Q5LWY3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWY3"
FT                   /protein_id="AAV93513.1"
FT                   /translation="MRFLLVEDNQSLASAILDRLRLDGHVVDHAANISLAEEFVITTDY
FT                   DLILLDIMLPDGDGRSFLKMQRDHRSETPVIVLTARSEVSDRVGVLDLGADDYLTKPFD
FT                   FSELEARCRAVLRRRGGRSSNQKRIGGLTFDPLSGLLEVCGLEVPLRNKELRLLEIFLA
FT                   APDQIFSKARLVDRLFSYDEEVSENAIEVYVGRLRKKIAGSGVEIQTVRGLGYRIRLQ"
     atgcggttcc tgttggtcga agacaatcag agtctggctt cggccatcct cgaccggctg        60
     cgtctggacg gacatgtggt ggatcacgcg gcgaatattt ccttggctga agaatttgtg       120
     atcacaacgg attacgattt gattttgctg gatattatgc tgcctgatgg ggatggccgc       180
     agttttctca agatgcagcg cgatcaccgc agcgaaacac cggtgatcgt gttgaccgcg       240
     cggtccgagg tctcggacag ggttggcgtt cttgaccttg gtgctgacga ctatctgacc       300
     aaacctttcg acttttccga gctggaggcg cgctgcaggg cggttttgcg gcggcggggc       360
     gggcgttcgt cgaaccagaa acgaatcggt gggctgactt ttgacccgct ttcgggcctt       420
     ctggaggtct gcggactcga ggtgcccctg cggaacaagg agttgcggct tctggaaatt       480
     tttctggccg cgcctgacca gattttctcc aaggcgcgtc tggtcgaccg gctgttttcc       540
     tatgacgaag aggtgtcgga aaacgcgatc gaggtttatg tcggccgatt gcgcaagaaa       600
     attgccggct ccggcgtcga gattcagacg gttcggggat tgggttaccg gatacgactg       660
     caatga                                                                  666
//

If you have problems or comments...

PBIL Back to PBIL home page