(data stored in ACNUC9435 zone)

EMBL: CP000031.PE184

CP000031.PE184       Location/Qualifiers
FT   CDS_pept        204870..206255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0188"
FT                   /product="sensor histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF00672; match to protein
FT                   family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0188"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93514"
FT                   /db_xref="GOA:Q5LWY2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013727"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWY2"
FT                   /protein_id="AAV93514.1"
FT                   /translation="MSDRLRSSGSIRRRLTIQLVGSAAVLAALLFLIVQTFTRELAEET
FT                   HDRILLASATSIMDAVSVRAREVSVDLPYAALSMLSNVSDDRVFYRVMLGAETLTGYDD
FT                   LPVPRPEPRAIGAMFETLVYKGESVRMATTVRWLSRNGVSTPLTISVAQTRTGQTERLA
FT                   DLTRTALLLGAGFFAVAVLLAVWTAQSSIRPLRELAGMVSRRGPTDLRPVTRPVPAEMA
FT                   PLVRSLNSFIDRLRLSLSRSEDFIAEAAHRVRTPLATVRTQAENTLHRIERPENRNALR
FT                   EMIRAIDESSRAAGQLLDHAMVSFRADSLERTPFDLTDLVAELVNRLRPVADLKDIELF
FT                   LEISGPHVMSGDPILVQNAVRNLLDNAIKYAPEESRVIVSLAGDATTHVLCIRDAAGGF
FT                   HEDEIDGLTERFVRGRNAEGTVGSGLGLTIAREVAEAHGGRLDIANTKDGAGACVCLHF
FT                   PSA"
     atgagcgacc ggttgcgctc cagcgggtcg atccggcgcc ggttgacgat acagttggtg        60
     ggcagcgcgg cggtgctggc ggcgttgttg tttctgatcg tgcagacctt tacccgcgaa       120
     ctggccgaag agacccatga ccggatcctg ctggcctcgg ccacgtcgat catggatgcg       180
     gtctcggtcc gggcgcgcga agtgtcggtc gatctgccct atgcggctct gtcgatgttg       240
     agcaatgtga gcgatgaccg ggtgttctat cgggtcatgc tgggggcaga gacgctcacc       300
     ggttatgacg atctgccggt gccccgacca gagccgcgcg cgatcggcgc gatgttcgaa       360
     acgctggtct acaagggtga aagcgtgcgg atggcaacta cggtgcgctg gctgtcacgc       420
     aatggggttt cgaccccgct gaccatatcg gtcgcgcaga ccaggaccgg acagacagag       480
     cggttggccg acctgacccg gacggcgttg ctgttgggtg cgggtttctt tgccgtggcg       540
     gttctattgg ctgtgtggac ggcgcaatcc tcgatccggc cattgcgaga gctggcgggc       600
     atggtgtcgc gccgggggcc gaccgacctg cgcccggtga cacgaccggt tccggcggaa       660
     atggcaccgc tggtccggtc gctgaacagt tttatcgacc gattgcggct ctcgctgtcg       720
     cgctcggagg attttatcgc cgaggcggcg catcgggtgc ggaccccgct ggcgacggtg       780
     cgcacccagg cagagaatac gctgcatcgg atcgagcggc ccgaaaatcg caacgccctg       840
     cgcgagatga tccgcgccat cgacgaaagc tcgcgcgcgg cggggcagtt gctggaccat       900
     gcgatggtaa gctttcgcgc cgacagtctg gagcgtacgc ccttcgatct gaccgatctg       960
     gtggcagaac tggtgaaccg gttacgcccg gtggccgatc tcaaggatat cgagctgttt      1020
     ctggagatat ccgggccgca cgtcatgtcc ggcgatccga tcctggtgca gaacgcggtg      1080
     cgcaatcttc tggataacgc aatcaagtat gcgcccgagg aaagccgggt cattgtctcg      1140
     ctggcaggcg atgcgacgac acatgttctg tgtatccgcg acgcagccgg tggcttccac      1200
     gaggacgaga tcgacggatt gaccgaacgt ttcgttcggg ggcgcaatgc cgaaggtacg      1260
     gtcggttccg ggctggggct gaccattgcg cgtgaagtgg ccgaggccca tggcgggcgg      1320
     cttgacattg ccaacacaaa ggatggagcc ggcgcatgcg tctgtctgca ctttccctct      1380
     gcctga                                                                 1386
//

If you have problems or comments...

PBIL Back to PBIL home page