(data stored in ACNUC7421 zone)

EMBL: CP000031.PE185

CP000031.PE185       Location/Qualifiers
FT   CDS_pept        206225..207250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0189"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:AAM42620.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0189"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93515"
FT                   /db_xref="GOA:Q5LWY1"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWY1"
FT                   /protein_id="AAV93515.1"
FT                   /translation="MRLSALSLCLTLWAAIAGAFEVEEHALFGAADGRVLRILSTTDTH
FT                   ILRPLIDSFLDARPGVAVDYLSVSSAEVMRAIVDEGERFDLVLSSAMDLQIKLANDGYT
FT                   RPHRSAWTPLVPDWGNWRDHVFAFSQETASVVLSRAAFADQDLPRTRQDLIDLLRSDPD
FT                   RFQGRVGTYDVAVSGLGYLFATQDARTAESYWRLMEVLGGLQVKLYCCSGEMIEAVAEG
FT                   RIDMAYNVLGSYARARTDLAESILVIEPEEYTNMMMRTAVIMRDAAEPDLAGAFADHLI
FT                   AAAWSDPPAPDYPFPGPPATDRPEGASLRPISLGPGLLVFLDRLKRQRFLEEWRNAVQQ
FT                   E"
     atgcgtctgt ctgcactttc cctctgcctg accctgtggg cggcgatcgc cggcgccttc        60
     gaggtcgagg aacacgcgct gttcggcgcc gcggatgggc gggtcctgcg tatcttgtcg       120
     accaccgaca cccatattct gcggccgctg atcgacagct ttctggacgc acggccgggg       180
     gttgcggtgg attacttgtc ggtcagcagc gccgaggtga tgcgggccat cgtcgacgaa       240
     ggagagcggt tcgacctcgt cctgtcctcg gcgatggatt tgcagatcaa gctggccaat       300
     gacggttata cccgacctca tcgctcggcc tggacgccgc tggttccgga ctggggcaac       360
     tggcgcgacc atgtctttgc cttttcgcaa gagacagcct cggtcgtgtt gtcgcgtgcg       420
     gcctttgccg accaggacct gccgcgtaca cggcaggacc tgatcgacct gctcaggagt       480
     gacccggaca ggtttcaggg tcgggtgggc acctatgacg tggcggtcag cgggcttggc       540
     tatctgtttg cgacccagga tgcgcgcacc gccgagagct attggcggtt gatggaggtt       600
     ctgggcggct tgcaggtcaa gctctactgt tgctcgggcg agatgatcga agcggtggcc       660
     gaggggcgca tcgacatggc ctataacgtt ctgggcagct atgcccgggc gcgtaccgat       720
     ctggcagaga gcatcctggt gatcgagccc gaggaataca ccaacatgat gatgcgcacc       780
     gcagtcatca tgcgcgatgc ggcagagccg gatctggcag gggcgtttgc cgatcatctg       840
     attgcggcgg cctggtccga cccgccggcg ccggactatc cctttcccgg ccctcctgcg       900
     acagaccggc cagagggggc ctcgctgcgc cccatttccc tggggccggg gctgctggtc       960
     tttctcgacc ggctcaaacg gcagcgtttc ctggaggaat ggcgcaacgc cgtccagcaa      1020
     gagtga                                                                 1026
//

If you have problems or comments...

PBIL Back to PBIL home page