(data stored in ACNUC7421 zone)

EMBL: CP000031.PE189

CP000031.PE189       Location/Qualifiers
FT   CDS_pept        211299..212750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0193"
FT                   /product="flagellar hook-associated protein FlgK, putative"
FT                   /note="identified by similarity to SP:P33235; match to
FT                   protein family HMM PF00460; match to protein family HMM
FT                   PF06429"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0193"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93519"
FT                   /db_xref="GOA:Q5LWZ4"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR002371"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWZ4"
FT                   /protein_id="AAV93519.1"
FT                   /translation="MTISAALNSALSGLTAASRATGVASDNIANALTPGYARRSLEVAG
FT                   NTIGGAGVRILGVVRNSDPVLLASRRGADAAQGYADGVSGFHTRMARLVGNVNDPRSVP
FT                   NLIAEFESSLIAAASTPSVQTRLDAVATAASELATALNAASNGLREARNDADRSIGQQV
FT                   DRLNTVLQNVETLNGRIQSVKLSGGDSAPLLDQRQKLIDEVNTMIPVNVVARDHGSVAL
FT                   FTDGGAILLDGPAAQLSFTPTLQTMPHMTLENGLLSGLELNGMPLRLSGPTSAIRGGSL
FT                   AAAFEVRDDLAIEAQQDLDAVARDLIERFEAPGLDPTAAPTDAGLFTDNGARFSASAQT
FT                   GLAGRLKLNASVDPGQGGQSWRLRDGLGAAVPGAVGNAQQINAFHQALTATRTPSDPRF
FT                   GTGDMTANQVGAALLSRVAQNESLATERLTFASASRTEMQKLELEQGVDTDVELQMLMQ
FT                   IEQAYAANARMIETVGEMMDTLLRL"
     atgaccatct cggccgcact caattcggcc ctcagtgggt tgaccgcggc aagccgtgca        60
     acgggggtcg cgtcagacaa tatcgcaaac gcgctcacac cgggctatgc caggcggtcg       120
     ctggaagtgg ctggcaacac gatcggaggg gcaggggtcc gcattctcgg agtggtccgc       180
     aattcggatc ctgtgttgct cgccagtcga cggggtgccg acgctgcgca gggatatgcg       240
     gacggtgtct ctggatttca tacccgcatg gcgcgcctgg tcggaaacgt caacgatccc       300
     cggtcggtgc ccaatctgat tgccgagttc gaaagcagcc tgatcgccgc agcaagcaca       360
     ccgtcggtcc aaacccgcct cgacgccgtc gcaaccgccg cctcggagct ggctacggca       420
     ctcaatgcgg cctccaacgg gctgcgcgag gcccgaaacg atgcggatcg aagcatcggc       480
     caacaggtcg accgtctcaa taccgtgttg cagaatgtcg aaacgctcaa tgggcgcatc       540
     cagtcggtca agctttccgg tggggattcc gcgcctctcc tcgatcagcg gcagaagttg       600
     atcgacgagg tcaacactat gatcccggtc aacgtggtcg cgcgtgatca cggcagtgtg       660
     gcgctgttca cagacggggg cgcaatcttg ctggatggcc cggcggcgca gctgagcttt       720
     acgccgaccc tccagaccat gccgcatatg accctggaaa acgggttgct gtccgggctc       780
     gaactcaacg gtatgccgct gcgcctctct ggtccgacct cggccattcg gggcgggtct       840
     cttgcggcgg cattcgaggt tcgagacgat ctggcaatcg aagcgcagca ggacctggat       900
     gcggtggccc gagacctgat cgaaaggttc gaggcaccgg gccttgaccc gaccgcagcg       960
     ccgaccgatg ccggattgtt taccgataat ggcgcgcgat tctcggcgag cgcgcaaacc      1020
     ggtttggcgg gacggttgaa actaaacgcc tcggtggatc caggccaggg cgggcagagc      1080
     tggcgcctgc gcgatggtct tggcgccgca gttcccggag cggtgggcaa tgcgcaacag      1140
     ataaatgcgt tccatcaagc gctgaccgcc acgcgcacac cgtccgatcc gcggttcgga      1200
     accggtgaca tgaccgccaa tcaggttggc gcggctctct tgtcccgggt tgcgcagaat      1260
     gaaagcctcg cgaccgaacg gctgacattt gcatccgcaa gccgaaccga aatgcagaaa      1320
     ctcgagctgg aacaaggtgt ggataccgat gtcgagttgc agatgctgat gcagatcgaa      1380
     caggcctatg cggcaaacgc acgcatgatc gagacggttg gcgagatgat ggacactttg      1440
     ctgaggttgt aa                                                          1452
//

If you have problems or comments...

PBIL Back to PBIL home page