(data stored in ACNUC7421 zone)

EMBL: CP000031.PE19

CP000031.PE19        Location/Qualifiers
FT   CDS_pept        18450..19280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0019"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0019"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93350"
FT                   /db_xref="GOA:Q5LWG2"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWG2"
FT                   /protein_id="AAV93350.1"
FT                   /translation="MKQQSATQVMVEGCFKMLGWRIFLYSIRMVLRNWRHALRLALVPA
FT                   ILGSVAMMTIAWVMQSGPAFEQFFGAGLNDLDKTEMTRQHTLSSLLVLVPQAVASLWIV
FT                   ITWHRFILLEEAQDGWVPPLRPGRTLAYFALSVGIVLIFAAVAFPVVYATVVLAAALGL
FT                   RGMAVALTLAVLLLLSPLSQRALLVLPASAIGQPLSFGDALTLTRDHYWTMLIVAVSGS
FT                   AMQHGLSTVLSFVGGTSTVGPVAALFLTLLLQPLLWASVLTTLYGVFVEKRPLG"
     atgaaacaac agagtgccac acaagttatg gttgaggggt gtttcaaaat gttaggttgg        60
     cggattttcc tgtattcgat ccggatggtt ctgcgcaatt ggcgacacgc tctgcggctg       120
     gcccttgtgc ccgcgatcct tggcagcgtg gcgatgatga caatagcctg ggtcatgcaa       180
     agcggccctg cgtttgaaca atttttcggg gcagggctca acgatctcga caagaccgag       240
     atgacccgcc agcatacgct ttcctcgctg ttggtccttg tgcctcaagc tgtagccagc       300
     ctctggatcg tgataacttg gcatcggttc attctgctgg aagaagcgca ggacggctgg       360
     gtgccgccct tgcgtccggg gcgaaccctc gcctatttcg ccctgtcggt ggggatcgtg       420
     ttgatctttg cggctgtcgc gtttcctgtt gtctatgcga cggtcgttct tgctgctgcg       480
     ttggggctgc gtggcatggc ggttgcgctc acgttagcgg tattgctgct tctgtcgccc       540
     ttgtcgcaaa gggcactact tgtcctgcct gcctctgcca tcggccaacc gctgagtttc       600
     ggtgacgcgc tgacgctgac acgcgatcac tactggacca tgctgattgt cgcggtatcg       660
     gggtctgcca tgcaacatgg gctttcgacc gtgctgtctt tcgtaggcgg aacctctacc       720
     gttgggccgg tcgccgcgct tttcctgacg ctgttgttgc aaccgctgct ctgggcgagt       780
     gttctgacca ctctctacgg ggtctttgtg gagaagcgcc cgcttggctg a                831
//

If you have problems or comments...

PBIL Back to PBIL home page