(data stored in ACNUC7421 zone)

EMBL: CP000031.PE190

CP000031.PE190       Location/Qualifiers
FT   CDS_pept        212754..213761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0194"
FT                   /product="flagellar hook-associated protein FlgL family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0194"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93520"
FT                   /db_xref="GOA:Q5LWZ3"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWZ3"
FT                   /protein_id="AAV93520.1"
FT                   /translation="MAMNSLGDLAQNLMLRSYGARIRTEINTLTRELSTGKVADVTKRL
FT                   RGDFSHLADMDRSLRRLSAFATANAETRLLASASQTSLGIVEQTVTDLSDSLLSVSLSN
FT                   QAVSHAQAGVKAQGALETMISALNTSVGGRSLFAGVATDQTALASADTLMAGLRSALTG
FT                   LSTPADIMQAAQDWFDDPAGFAATVYTGSDQSLGSTQVSEDTKVSLNRRADDPAFRDAM
FT                   RLASVAALAEDPALGLSSTTKTALFEQIGVGLLGARDGVVTLQAEIGDVEGRIEKAATR
FT                   NGAAKSGLELARGELLSADPYETAIRLEAVQFQLESLYTTTVRNSRLSLVNFLR"
     atggctatga attccttggg agatctagca cagaatctga tgttgcgcag ctatggtgcc        60
     cgcatccgga ctgagatcaa taccctgacg cgcgagttga gcaccggcaa ggtagccgat       120
     gttaccaaaa ggctcagggg tgatttctcg catcttgccg atatggatcg atctttgcga       180
     cggctgtcgg ccttcgcgac cgcaaatgcc gagaccaggc tgctggcgtc tgcgagccag       240
     acaagtcttg gtatcgtcga acagacggtc accgatcttt cggattccct gttgtcggta       300
     tcgctttcga accaggcagt cagccatgcg caagcgggcg tgaaggccca gggtgcacta       360
     gagacgatga tctctgccct gaacacatcg gtgggcgggc gcagcctgtt tgcgggcgtg       420
     gcaaccgatc agacggcgct ggcctctgcc gatactctga tggcggggtt gcggtcggcg       480
     ctgaccggtc tgtcgacgcc cgccgatatc atgcaggctg cgcaggattg gtttgacgac       540
     cccgcaggtt tcgcggcaac agtctatacc ggatcggatc agtctctcgg atcgactcag       600
     gtgtccgaag acaccaaggt gtcgctaaac aggcgggccg acgatccggc ctttcgcgat       660
     gcaatgcgcc tggcctcggt tgcggccctg gctgaagatc cggcccttgg cctgtcttcg       720
     acaaccaaga ccgcattgtt tgagcagatc ggagtgggtc ttctgggtgc ccgcgacggg       780
     gtggtcacgc ttcaggccga gatcggagat gtagagggtc ggatcgaaaa ggctgccacc       840
     cgaaacggag cagcaaagag cggtctcgaa ctcgcgcgcg gcgagttgtt gagcgccgac       900
     ccctatgaga ccgctattcg ccttgaggcc gtgcagtttc agctggaaag cctttacaca       960
     accaccgtgc gcaactcgcg cctctcattg gtgaatttcc tcagatga                   1008
//

If you have problems or comments...

PBIL Back to PBIL home page