(data stored in ACNUC7421 zone)

EMBL: CP000031.PE197

CP000031.PE197       Location/Qualifiers
FT   CDS_pept        218871..219290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0201"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:AAF27716.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0201"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93527"
FT                   /db_xref="GOA:Q5LWY7"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWY7"
FT                   /protein_id="AAV93527.1"
FT                   /translation="MELIADILLVAGALGAGLYCFVLGRRLKRFNDLERGVGGAVAVLS
FT                   SQVDELNRTLAAAREASDNSGAALGDLTGRAEAVAQRLELMMASMHDVAPAQEVSAPPE
FT                   VVRQEPKPARPDEAKPAPAGVMFMRHDRGNSGTTP"
     ttggaactta ttgcggatat tcttctggtt gccggcgcgt tgggcgctgg tttgtattgt        60
     ttcgttctcg gtcggcgatt gaagcggttc aatgacctcg aaagaggggt cggcggtgcg       120
     gttgcggtgc tgtcctctca ggtcgacgag ctgaacagga cgctcgcggc cgcgcgcgag       180
     gcgtcagaca attcaggcgc cgcactggga gacttgaccg ggcgtgccga ggcggttgcg       240
     cagcggcttg agctgatgat ggcgtcgatg catgacgtcg cacctgcgca ggaggtatcg       300
     gcgccgcccg aagtggtccg gcaagaaccc aaaccggcgc gccccgatga ggcgaaaccg       360
     gcacccgccg gcgtgatgtt catgcggcat gaccggggca atagcgggac aacgccatga       420
//

If you have problems or comments...

PBIL Back to PBIL home page