(data stored in ACNUC9435 zone)

EMBL: CP000031.PE200

CP000031.PE200       Location/Qualifiers
FT   CDS_pept        220807..223038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0204"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0204"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93530"
FT                   /db_xref="GOA:Q5LX00"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX00"
FT                   /protein_id="AAV93530.1"
FT                   /translation="MMQRILAVFLLLYLALPVAAAEVEVRSGEHQSFTRLVMRIPSQTK
FT                   WTLENSTGSARLKVDLPDLKLDYGEVFDRVPRKRLSELHQEKAGAPLELQFACDCEARA
FT                   FVQGGTLLVIDIRDRPASDPPLVLPLVPERVLASGDGVGADHPIEDREEDSGVAVNPRS
FT                   QPSGGASQHTFLDFSAPMAGERTVENRLYSRIMRGVDQEVLALSPREATDPDDQISAAQ
FT                   AALTETLAAGLGLPNLRVTTVVDRDLRAAREGTASPTIARKCVDDQKLAVPDWADDSPF
FT                   STQYAVLRDGLYGEFDRINAQAALALVRFYIHFGFGDEAKVNLELLQPASPDRQLLASL
FT                   AAAVEGRPAPVDNPLAGLQGCDNDAAMWSVLSERHAPETTNTNAVLRSYGRLPVHLRAY
FT                   LGPVLGEYLTDAGFVDAAQQLVRAVERSDEGDKASIAVVEAKLAGLKNEPAVQEQKLTE
FT                   VIEDASASTHAPLALIDLIEKRWVEGGDVTEQELLLAASFVHEYRRSEIGPQIQTAYVI
FT                   AQALSAQFDEAMKTLLDPGQDRKSQVWRETVDRIVKRITSHGDDITFLRHVAMLESDLF
FT                   LSVNTDTVTQVARRLNDLGFFEDALRYADRPQDRKSRPARVEIIARATLGTGRPHRALL
FT                   ELETASGPEVERLRAQAMREAGALEQAAEALTRAGDLEAASRYLWLAGAEAPIDGGEET
FT                   RFGGIHLMGRALLEEREPSSGTPLAAAREMVDDSARVRDQIDSLLNRLP"
     gtgatgcaga ggatactggc cgtattcctt ttgctctacc tggctttgcc ggtggcggca        60
     gccgaggtcg aggtacggtc gggcgagcat cagagtttca cccgactggt tatgcgcatc       120
     ccgagccaga ccaagtggac ccttgaaaac agcacagggt cggcccgatt gaaagtcgat       180
     cttcccgacc tgaaactgga ctatggtgaa gtgttcgacc gtgtgccgcg caagcggctt       240
     tcggagttgc accaagagaa agctggcgct ccgctcgagt tgcaatttgc ctgcgattgc       300
     gaagcgagag cctttgttca aggtggtaca ttgcttgtga tcgacatacg ggacaggccc       360
     gcaagtgatc cgccgctggt gctgcccctt gtacctgagc gcgtgcttgc gtctggggac       420
     ggagttggcg ccgaccatcc gatcgaggat cgcgaggagg attcgggggt tgccgtcaac       480
     ccccggtccc aaccgtcagg gggtgccagc cagcacacct ttctggattt ctccgccccg       540
     atggccggag agcgaacggt ggaaaacagg ctttactcac gcatcatgag aggagttgat       600
     caggaagttc tggctctcag ccctcgagag gcgacggacc ctgatgacca gatttcagcg       660
     gctcaggccg cgttgaccga aacgctcgct gcggggttgg ggttgccgaa cctgcgcgtg       720
     acgacggtgg ttgatcgcga cctgcgtgct gcgcgcgagg gaactgccag cccgacaatt       780
     gcgcgcaagt gtgttgacga tcagaaactg gcggtcccgg attgggcgga cgatagccct       840
     ttcagtaccc aatacgcggt cttgcgagat ggcctttatg gtgagttcga caggatcaat       900
     gcgcaggccg cactggcact tgtccggttt tacattcatt tcgggttcgg agacgaagca       960
     aaagtcaatc tggagttgct gcaacccgca tccccggatc gtcaactgct cgcatcgctt      1020
     gccgccgctg tcgaagggcg tccggctccg gtcgacaatc ccttggcggg gcttcaggga      1080
     tgcgacaatg atgcggcgat gtggtcggta ctcagcgaga ggcatgcccc tgaaacaacg      1140
     aatacaaacg cagttctgcg cagctatggg cgcctacccg tgcatttgcg cgcctatctc      1200
     ggccccgtct tgggagagta tttgaccgat gccggtttcg tcgacgcggc tcagcaattg      1260
     gtgcgggcgg tagagcggag tgatgaaggg gacaaggcgt ccatagccgt tgtcgaggcc      1320
     aaacttgccg ggctcaagaa cgagccggct gttcaggagc agaagctgac cgaggtgata      1380
     gaagacgcgt ccgcttcgac ccatgcaccg ctcgccttga ttgatctgat cgaaaagcgc      1440
     tgggtcgagg gcggtgatgt gaccgagcag gagttactgt tggccgcgtc attcgttcac      1500
     gaatatcgcc ggtcggaaat cgggccgcag atacaaacgg cctatgtgat cgcacaggct      1560
     ctgtcagcgc agttcgacga ggcgatgaag acgttgctgg atccgggcca ggatcgaaaa      1620
     tcccaagttt ggcgggaaac ggtcgaccgc atcgtgaagc ggatcacctc tcacggagat      1680
     gacatcacat ttttgcgtca cgtcgccatg cttgaaagcg atctttttct gtcggtgaac      1740
     actgataccg tgacgcaggt ggcgcggcga ttgaatgatc tgggtttttt tgaggacgcg      1800
     ctgcgctatg ccgaccgacc gcaagatcgc aagagccgtc ctgcgcgggt cgagatcatt      1860
     gcccgtgcga cgcttggcac cggtcgtccg catcgggcgt tgctggaact tgaaacagcc      1920
     agtggtcccg aggtagagcg cctacgcgcc caggccatgc gagaagcagg agcgttggaa      1980
     caggcagcag aggcattgac gcgcgctggt gatctggagg cggcgagccg gtacctttgg      2040
     ttggctggtg ccgaggcgcc gattgatggc ggcgaagaaa cccggtttgg cgggattcac      2100
     ttgatgggcc gtgccctgct ggaagagcgg gaaccatcct cgggaacgcc gcttgccgcg      2160
     gcgcgggaaa tggttgacga cagcgcgcgg gtacgtgacc agatcgactc cttgttgaat      2220
     cgtttgccgt ga                                                          2232
//

If you have problems or comments...

PBIL Back to PBIL home page