(data stored in ACNUC7421 zone)

EMBL: CP000031.PE201

CP000031.PE201       Location/Qualifiers
FT   CDS_pept        complement(223341..224723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0205"
FT                   /product="MmgE/PrpD family protein"
FT                   /note="identified by similarity to GB:AAO56546.1; match to
FT                   protein family HMM PF03972"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0205"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93531"
FT                   /db_xref="GOA:Q5LWZ9"
FT                   /db_xref="InterPro:IPR005656"
FT                   /db_xref="InterPro:IPR036148"
FT                   /db_xref="InterPro:IPR042183"
FT                   /db_xref="InterPro:IPR042188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWZ9"
FT                   /protein_id="AAV93531.1"
FT                   /translation="MTKQQSSLSPTFGRIAAFALDTRSEDIPAPVREAAALMMLDTLGV
FT                   IAAASPLDAGVIARDSATLLYGSADPRYQARMMFDGRAVSLAGATYAAATQTDNLDGHD
FT                   GYNPTKGHIGVVVIPTLATLAQHLPDLSGPEALAAVTVGYEVAGRAGIALHATVSDYHT
FT                   SGAWNCLGVAAMAARLRGQDPETLRQAMGIAEYHGPRSQMMREIATPTMLHDGSGWGAL
FT                   VGTSAAILAERGFTGAPAITAEAEEAAPYWADLGRFWQMQHQYVKPYPICRWAHAAIDG
FT                   VRQVMLDHRLSHADIAQVHVNSFHQAACLYQGLPPTTAIAQYALPFPVAVQIAYGRIGV
FT                   EHVAGSGLTDPLVAEIMQRITVSEDPRHSSRFPAGRWADVEITTTDGRVLKSGDINARG
FT                   GPEAPMTRDELTDKFMDFAVPCLGRARASALRDATLGLTAPDSRFCDVMDLLFDPIGQT
FT                   IV"
     atgacaaagc agcaaagcag cctgtccccc acattcgggc gcatcgccgc ctttgcactc        60
     gacacccggt ccgaggatat ccccgccccg gtgcgcgagg ccgccgcgct gatgatgctc       120
     gacacgctcg gggtaatcgc cgcggccagc ccgctcgacg cgggcgtgat cgcacgcgat       180
     tccgcgaccc tgctctatgg gtcggccgac ccgcgttacc aggcgcgcat gatgttcgac       240
     gggcgcgcag tcagccttgc cggggcgacc tatgccgccg ccacccagac cgataatctc       300
     gatgggcatg acggctacaa cccgaccaag ggtcatatcg gggtggtggt gatccctacc       360
     ctggcaacgc tggcgcagca tctgcccgac ctctcgggcc ccgaggcgct ggccgccgtg       420
     acggtcggct atgaagtggc ggggcgcgcg ggtatcgcgc tgcacgccac cgtcagcgac       480
     taccacactt cgggcgcctg gaactgcctt ggcgtcgcag caatggccgc ccggctgcgc       540
     ggacaagacc ccgagacgct gcgccaggcc atgggcatcg ccgaatacca cggcccacgc       600
     agccagatga tgcgcgagat cgcgacaccg acgatgctgc atgacggttc gggctggggt       660
     gcgctggtcg gcacgtcggc agcgatcctt gccgaacggg gtttcaccgg cgcgccggcc       720
     atcaccgccg aggcggaaga ggccgccccc tactgggcgg atctgggccg gttctggcaa       780
     atgcagcacc aatatgtgaa accctacccc atctgtcgct gggcgcatgc cgccattgac       840
     ggggtacggc aggtgatgct ggatcaccgg ctgtcgcacg ccgatattgc gcaagttcat       900
     gtgaacagct ttcatcaggc ggcttgcctc tatcaggggc tgccgccgac caccgcgatc       960
     gcgcaatacg cgctgccctt tccggtcgct gtccagatcg catatgggcg tatcggggtc      1020
     gaacatgtcg ccggatccgg cctgaccgat ccgctggtgg ccgagatcat gcagaggatc      1080
     accgtaagcg aagacccccg ccacagcagc cggtttccag ccggtcgatg ggcagatgta      1140
     gagatcacca ccaccgatgg gcgcgttctg aaatcgggcg atatcaacgc ccgtggcggt      1200
     cccgaagcgc cgatgacccg cgacgagctt accgacaaat tcatggattt cgctgtgccc      1260
     tgccttggtc gggcccgggc ctcggcgctg cgagacgcaa ccctgggcct gaccgccccg      1320
     gacagccgct tctgtgatgt gatggatctt ctgttcgacc caatcggtca aaccatcgtt      1380
     tga                                                                    1383
//

If you have problems or comments...

PBIL Back to PBIL home page