(data stored in ACNUC7421 zone)

EMBL: CP000031.PE203

CP000031.PE203       Location/Qualifiers
FT   CDS_pept        complement(225805..228222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0207"
FT                   /product="aminomethyl transferase family protein"
FT                   /note="identified by match to protein family HMM PF01266;
FT                   match to protein family HMM PF01571"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0207"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93533"
FT                   /db_xref="GOA:Q5LWZ7"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="InterPro:IPR032503"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWZ7"
FT                   /protein_id="AAV93533.1"
FT                   /translation="MKTHAQAVVIGGGLVGCSILYHLAKLGWRDVVLLERDELTSGSTW
FT                   HAAANIHGLHDNNNVTRIQHYTMNLYKELEKETGQGCGVFQAGSLYLAQTEAREHQLRL
FT                   QEAKARYYGLNFYEIDKDRAKELHPLAQFDDIRCIMYEPDGGNVDPSGVTYAYAAGARA
FT                   MGATIERFCPVIGTEPQPDGSWIVRTEKGDIHTQWVVNAAGLWGREVAALAGITLPLQP
FT                   TEHQYFVTEAIPEVAALGRRLPSIADRDGEYYFRQEGNGLLIGAYEKDMKFWAENGTPL
FT                   DFAHDLFPDDLDRIMENVIRATERVPVAATAGVKRVINGPMIWSPDSSALWGPVPELRN
FT                   YFVCGGIIPGFSQSGGLGLLAAQWMIEGEPQNDMFAWDLARFGDWADKTFTKARVQDQY
FT                   THRFAIHFPNEERSAGRPARVRPAYEMQQQMGAVFGMNCGWEHPLWFADQPGVSETVGF
FT                   TRQNWWEPVGREARMLREQVGVIDISNFANYEIKGPGAHDWLDRLVANRVPTVEGRSCL
FT                   TPLIGVRGGIAGDFTITMTGEDAYMMVGSGMAERYHQRFFNMVDLPEGTTCEVATNRIA
FT                   GYNVAGPRAREMLQRLTNADLSNAGFPFMRSATIEVAGVACLAIRVSFTGDLGCELHCA
FT                   EGDQVRLYTALIAAAREVGGGPVGSRALGSLRIEKGYGSWGREYSPEYWPQEVGLDRLI
FT                   KADKDFLNKAAWLKIKDYPVREVLSVFEIEAVHGADASGGEPIFTPDGRPAGRVTSGAY
FT                   GYSVGKSLAIGFVNPAVAQPGDVLEVFILGKPHRAVLLAEPPFDPAGARLRG"
     atgaagaccc atgcccaggc cgttgtgatc ggcggtggcc ttgtcggttg ctcgatcctt        60
     tatcacctgg ccaagctggg ctggcgcgat gtcgtgctgc tagagaggga cgaactgacc       120
     agcggatcga cctggcatgc ggccgcaaac atccacgggc tgcacgacaa caacaacgtc       180
     acccgtatcc agcattacac gatgaacctg tacaaggagt tggagaagga gaccggtcaa       240
     ggctgcggtg tgttccaggc gggctcgctt tacctcgcgc agaccgaggc gcgcgaacac       300
     cagcttcggc tgcaagaggc caaggcgcgg tactatgggc tgaatttcta cgagatcgac       360
     aaggaccgtg caaaggagct gcatccgctg gcgcagttcg acgatatccg ctgtatcatg       420
     tacgaacccg atggcggcaa cgtggacccc tcgggcgtga cctatgccta tgccgccgga       480
     gcccgcgcca tgggcgccac gatcgagcga ttctgcccgg tgatcggcac cgagccccag       540
     ccggatggca gttggatcgt gcgcaccgag aagggcgaca ttcacacgca atgggtggtc       600
     aatgcggcgg gcctgtgggg gcgcgaggtg gcggcgctgg cggggatcac cctgccgttg       660
     caaccgaccg agcatcagta cttcgtgacc gaggcgatcc ccgaggtggc cgcgctgggc       720
     cgccgcctgc cctcaatcgc ggaccgggac ggcgagtatt acttccggca ggaaggcaac       780
     gggctcctga tcggcgccta tgaaaaggac atgaagttct gggccgaaaa cggcacgccg       840
     ctggatttcg cccatgacct gttccccgac gatctggacc ggatcatgga aaacgtgatc       900
     cgcgccaccg agcgggtgcc ggtggcggcg acggcggggg tcaagcgggt gatcaacggg       960
     ccgatgatct ggtcgccgga ttcgagcgcg ttgtggggac cggtgccgga actgcggaac      1020
     tatttcgtct gcggcggtat cattcccggc ttctcgcaat cggggggtct gggcctgttg      1080
     gcggcgcaat ggatgatcga gggcgagccg caaaacgaca tgttcgcctg ggacctggcg      1140
     cggttcggtg actgggccga caagacattc accaaggcgc gggtgcagga ccagtacacc      1200
     caccgctttg ccatccattt ccccaacgag gagcgcagcg ccgggcgccc ggcgcgggtg      1260
     cgacccgcct atgaaatgca gcagcagatg ggcgcggtgt tcggcatgaa ctgtggctgg      1320
     gagcatccgc tgtggtttgc ggaccagccg ggcgtgagtg aaaccgtggg cttcacccgc      1380
     cagaactggt gggagccggt gggccgcgag gcgcgcatgt tgcgtgagca ggtgggcgtg      1440
     atcgacatct cgaactttgc caattacgag atcaaggggc cgggtgcgca cgactggctg      1500
     gaccggctgg tggcgaaccg ggtgcccact gtcgagggca gatcctgtct gacgccgctg      1560
     atcggcgtgc ggggcgggat cgcgggcgat ttcaccatca ccatgacggg cgaggatgcc      1620
     tatatgatgg tgggctcggg catggccgag cgttatcatc agcggttctt caacatggtg      1680
     gatttgcccg agggcaccac atgcgaggtc gcgaccaacc gcattgcggg ctataacgtg      1740
     gccggaccca gagcgcgcga gatgttgcag cggctgacca atgccgatct ctcgaacgcg      1800
     ggctttcctt tcatgcgctc ggccacgatc gaggtggcgg gggtggcctg cctggcgatc      1860
     cgggtcagtt tcaccggtga tctgggctgt gagctgcatt gcgccgaggg cgatcaggtg      1920
     cggctttaca ctgcgctgat tgctgcggcc cgcgaggtcg gcggcgggcc ggtgggcagc      1980
     cgggcactgg ggtccttgcg catcgaaaag ggctatggct cctggggccg ggaatacagc      2040
     ccggaatact ggccacagga ggtggggctg gaccggctga tcaaggcgga caaggacttc      2100
     ctgaacaaag cggcctggct gaagatcaag gactacccgg tgcgcgaggt gctgtcggtc      2160
     ttcgagatcg aggccgtgca tggggcggac gccagtggcg gcgaaccgat ctttaccccc      2220
     gatgggcgcc cggccgggcg ggtgacctcg ggcgcctatg gttactcggt gggcaagtcg      2280
     ctggccatcg gtttcgtcaa tccggcggtg gcgcaaccgg gcgacgtgct ggaggtgttc      2340
     atccttggca aaccgcaccg ggcggtgctg ctggccgaac cgcccttcga tcctgccggc      2400
     gcgcggttga ggggttag                                                    2418
//

If you have problems or comments...

PBIL Back to PBIL home page