(data stored in ACNUC7421 zone)

EMBL: CP000031.PE21

CP000031.PE21        Location/Qualifiers
FT   CDS_pept        complement(20571..20924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0021"
FT                   /product="Hpt domain protein"
FT                   /note="identified by match to protein family HMM PF01627"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0021"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93352"
FT                   /db_xref="GOA:Q5LWI0"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWI0"
FT                   /protein_id="AAV93352.1"
FT                   /translation="MGQRERRCAMIHWPRVTQLREEVGAEDFEEVVDLFLEEVEEVITR
FT                   LRQAPDRSLLEKDLHFLKGSALSLGFQSFSALCQDGERQSAAGHADTVDLDAIINSFEA
FT                   SKSVFQSELPGHI"
     atggggcaga gagaacggag gtgcgccatg attcactggc cccgcgtgac ccaattgcgg        60
     gaagaggtcg gtgcggagga tttcgaagag gttgtggacc tgttcctgga agaggtcgaa       120
     gaggtgatca cgcgtcttcg gcaggcaccg gatcgcagcc tgcttgaaaa ggatctgcat       180
     tttctcaagg gcagcgcgct cagccttggg tttcagtcct tttccgccct gtgccaggat       240
     ggcgagcggc aatcggccgc cggtcatgcg gacacggtcg acctggatgc catcatcaac       300
     agtttcgagg cgtcgaaatc ggtgttccaa tcggaactgc ccggtcatat ctga             354
//

If you have problems or comments...

PBIL Back to PBIL home page