(data stored in ACNUC9435 zone)

EMBL: CP000031.PE214

CP000031.PE214       Location/Qualifiers
FT   CDS_pept        239625..240011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0219"
FT                   /product="iojap-related protein"
FT                   /note="identified by match to protein family HMM PF02410;
FT                   match to protein family HMM TIGR00090"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0219"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93544"
FT                   /db_xref="GOA:Q5LX03"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX03"
FT                   /protein_id="AAV93544.1"
FT                   /translation="MPAHAGAKMMAQGTYTSEQLLDRILTSLNDDKAEDLVQIDLRGKT
FT                   SMGDYMVIASGRSTRQVSAMAEKLVQRLKDEFGLNSKIEGKDAGDWVLIDTGDVIVHIF
FT                   RPEVREFYQLEKMWMPQGAKTSAN"
     atgcccgccc atgcaggggc caaaatgatg gcccaaggca cttataccag cgaacagctg        60
     ctggaccgca ttctgacctc tctcaacgat gacaaggccg aagacctcgt gcagatcgac       120
     ctgcggggca agacctcgat gggcgattat atggtcatcg cctcgggccg gtcgacccgt       180
     caggtctcgg ccatggccga gaagctggtg cagcgtctga aggatgagtt cggcctgaac       240
     tccaagatcg agggcaagga tgccggcgac tgggtgctga tcgataccgg cgacgtgatc       300
     gtgcatatct tccgtccgga agtgcgcgag ttctatcagc tggaaaagat gtggatgccg       360
     cagggcgcca agacatcggc caactaa                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page