(data stored in ACNUC7421 zone)

EMBL: CP000031.PE216

CP000031.PE216       Location/Qualifiers
FT   CDS_pept        240537..241022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0221"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:CAE38612.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0221"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93546"
FT                   /db_xref="GOA:Q5LX19"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX19"
FT                   /protein_id="AAV93546.1"
FT                   /translation="MAELLIVYHSRTGGSRQMAEACAAGAQSEIATTLLTAEAAGPEDL
FT                   LRASGYVFCCPENLAAISGAMKEFLDRCYYPVLGRIEGRAYAQMICAGSDGQNAARQLA
FT                   RIATGWRLKEVQPPLILCTHAQTPEAIQAPKHIPEAELGQCRDLGQALGAGLAMGMF"
     atggcagagc tgttgatcgt ctatcactcg cgcaccggag gcagccgtca gatggccgag        60
     gcctgcgccg cgggcgcgca gagcgagatc gccacaacgc tgctgacagc tgaggcagca       120
     ggccctgagg acctgctgcg cgccagtggt tacgtgttct gctgcccgga aaatctggcg       180
     gcgatctcgg gcgcgatgaa ggaattcctt gaccgctgct actaccccgt tctgggccgg       240
     atcgaggggc gcgcctatgc gcagatgatc tgcgccggat cggacgggca gaacgccgcc       300
     cggcaactgg cgcgcatcgc caccggctgg cgcctgaaag aggtgcagcc gccgctgatc       360
     ctgtgcaccc acgcgcagac gcccgaggcg attcaggccc ccaaacacat acccgaagcc       420
     gagcttggtc aatgccgcga cctgggccag gcgctgggcg ccgggctggc gatgggcatg       480
     ttctga                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page