(data stored in ACNUC7421 zone)

EMBL: CP000031.PE218

CP000031.PE218       Location/Qualifiers
FT   CDS_pept        242364..242822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0223"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="identified by match to protein family HMM PF01037"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0223"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93548"
FT                   /db_xref="GOA:Q5LX17"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX17"
FT                   /protein_id="AAV93548.1"
FT                   /translation="MSLDATDRKILTALQAKGRMSNAELSDKANLSPSACHRRVQRLEA
FT                   EGYIRNYVALLDARKMGLPTTVFVEITLQGQADEVLDAFEKAVARIPDVLECHLMAGTA
FT                   DYILKVVAENTEDFARIHRQHLSRLPGVAQMQSSFALRTVFKTTALPV"
     atgagcctcg acgcgacgga tcgcaagatt ctcaccgccc ttcaggcaaa gggccggatg        60
     tccaatgcgg aactgtccga caaggccaac ctgtcgccat cggcctgtca ccggcgggtc       120
     cagcggctcg aggccgaagg ttatatccgc aattacgtgg ccctgctgga cgcccgcaag       180
     atgggcctgc cgacaacggt ttttgtcgag atcaccctgc agggtcaggc cgacgaggtg       240
     ctggacgcgt ttgaaaaggc ggtggcgcgc attcccgatg tgctggaatg ccacctgatg       300
     gccggaacgg cggattacat tctcaaagtg gtggccgaaa acaccgagga tttcgcccgc       360
     atccaccgcc agcacctgtc ccgcctgccc ggggtggccc agatgcaaag ctcgttcgcg       420
     ctccggaccg tgttcaagac aacggccctg ccggtctga                              459
//

If you have problems or comments...

PBIL Back to PBIL home page