(data stored in ACNUC7421 zone)

EMBL: CP000031.PE219

CP000031.PE219       Location/Qualifiers
FT   CDS_pept        242986..243903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0224"
FT                   /product="polyphosphate kinase, putative"
FT                   /note="identified by similarity to GB:AAN87337.1; match to
FT                   protein family HMM PF03976"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0224"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93549"
FT                   /db_xref="GOA:Q5LX16"
FT                   /db_xref="InterPro:IPR016898"
FT                   /db_xref="InterPro:IPR022486"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LX16"
FT                   /protein_id="AAV93549.1"
FT                   /translation="MTHESDDPSLDWLEAELEDSLDEDFEIEFSEPMLSMEIRRIYKDQ
FT                   RPDLLDRQVYFRNLLRLQAELIKLQDWVQHTNSKVLIIMEGRDAAGKGGVIKRITQRLN
FT                   PRIARVVALPAPSRREQSQWYFQRYVPYLPSGGEMVLFDRSWYNRAGVERVMGFATEDQ
FT                   VEQFFQDVPEFERMLVRSGIILLKYWFSITDEEQQLRFLMRVHDPMKQWKLSPMDLESR
FT                   IRWEQYTKAKEQMFSRTNIPEAPWYIVEGNDKKRERLNCIEHLLSKIPYEDIPHEKVTL
FT                   PDRRYNPDYERQVLPDELYVPKVY"
     ttgacccatg aatccgacga ccccagcttg gattggctcg aggccgaatt ggaggattcg        60
     ctggatgagg atttcgagat cgaattcagc gaaccgatgc tgtcgatgga aatccgccgg       120
     atctacaagg atcagcgccc cgatctgctc gaccgccagg tctatttccg caacctgctg       180
     cggctccagg ccgagctgat caagttgcag gactgggtgc agcacaccaa ttccaaggtg       240
     ctgatcatca tggaaggccg cgatgccgcc ggcaagggcg gggtgatcaa acggatcacc       300
     cagcggctga atccgcggat cgcgcgggtg gtggcactgc ctgcgccgtc ccggcgtgaa       360
     cagagccagt ggtacttcca gcgctacgtt ccctatctgc cctcgggggg cgaaatggtg       420
     ctgttcgacc ggtcctggta caaccgcgcc ggggtcgaac gggtgatggg ttttgccacc       480
     gaggatcagg tcgaacagtt tttccaggac gttcccgaat tcgagcgcat gctggtacgc       540
     tcggggatca tcctgctgaa atactggttc tcgatcaccg acgaagagca gcagctgcga       600
     ttcctgatgc gggtgcacga tccgatgaaa cagtggaaac tgtcgccgat ggacctggaa       660
     agccggatcc gctgggagca atataccaag gccaaggaac agatgttctc gcgcaccaac       720
     atccccgagg cgccttggta tatcgtcgag ggcaatgaca agaagcgtga gcggctgaac       780
     tgcatcgagc atctgttgtc caagatccct tatgaggaca tcccgcacga gaaggtcacg       840
     ctgcccgacc gccgctacaa ccctgactat gaacgccagg tgctgcccga cgaactttac       900
     gttcccaagg tctattga                                                     918
//

If you have problems or comments...

PBIL Back to PBIL home page