(data stored in ACNUC9435 zone)

EMBL: CP000031.PE22

CP000031.PE22        Location/Qualifiers
FT   CDS_pept        21005..22342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0022"
FT                   /product="response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF07228"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0022"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93353"
FT                   /db_xref="GOA:Q5LWH9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWH9"
FT                   /protein_id="AAV93353.1"
FT                   /translation="MLTGTCLAWAVSLALVKSGQTTVLHGREMEAQTDMEPGAIRRVLV
FT                   VDDSRLQRRILSSSLKKWGFEVIEAESGEEAMEICARAMPDLVLSDWVMPGMSGVDFCE
FT                   AFRQLNSDRYCYFILLTSKSEKNEVAQGLDAGADDFLIKPVSSDELRARISAGDRVIGM
FT                   QRELSAKNEVIEQALDDLKRAHDAIDKDLIQARKIQESLVPDFSQDFGSSRISLLLKPC
FT                   GHIGGDLVGMFSPGPNRVGFYSIDVSGHGITSAMMTARLGGYLSSRYFDQNVAMEKRFN
FT                   KFFALRQPQDVAETLNSRLIADTGIEEYFTMVYAIMDLRSGMLRMVQAGHPHPLLLRRD
FT                   GTAEFIGEGGVPIGLLPGVPFTQVEVQMEVGDRLLLYSDGFTECRLANGEMLEPEGLLA
FT                   LVNECNPEQGGQEFLDDLFWRLTQVMSPEHGLEDDVSATFFEFNGP"
     atgttaacgg ggacctgcct agcgtgggcc gtatccttgg ccttggtgaa atcgggacag        60
     acaacagtgt tgcatggtag ggaaatggag gcccagaccg atatggaacc gggcgcaatc       120
     cgccgggtgc tggttgttga cgacagccgg ttgcagcgcc gcatcctgtc gagctcgctg       180
     aagaaatggg gattcgaggt gatcgaggcc gaaagcggcg aggaggcgat ggaaatctgc       240
     gctcgcgcca tgcccgatct ggtgttgagc gactgggtca tgccggggat gagcggcgtc       300
     gatttctgcg aggcgttccg gcaactgaat tctgaccgat actgctattt catcctgctt       360
     acatcgaaga gcgaaaagaa cgaggtggcg caggggctgg atgccggggc cgacgatttc       420
     ctgatcaagc cggtcagctc ggacgagctg cgggcgcgga tttcggccgg ggaccgcgtg       480
     atcggcatgc agcgagagct ttcggccaag aacgaagtga tcgaacaggc gctggacgat       540
     ctgaaacgcg cccatgacgc catcgacaag gacttgatcc aggcgcgcaa gattcaggaa       600
     tcgctggtgc ccgacttcag ccaggatttc ggttcctcgc ggatcagcct gctgctgaaa       660
     ccctgtgggc atatcggcgg cgatctggtg ggcatgttct cacccgggcc gaaccgggtc       720
     gggttctaca gcatcgacgt ttcaggccat ggcatcacct cggcgatgat gaccgcgcgt       780
     ctgggtggct atctgtccag ccgctatttc gaccagaatg tcgcgatgga gaagcggttc       840
     aacaagtttt tcgccctgcg ccagccgcaa gacgtggccg agaccctcaa ctcccgcctg       900
     atcgccgata ccgggatcga ggaatatttc accatggtct acgcgatcat ggacctgcgc       960
     agcggcatgt tgcggatggt gcaggccgga cacccgcacc cgctgctctt gcgtcgggac      1020
     ggtacggcgg aattcatcgg tgagggtggc gttcccatcg gtctgttgcc gggcgttccc      1080
     tttacccagg tcgaggtgca gatggaggtt ggtgaccggc ttctgcttta ctccgacggg      1140
     tttaccgaat gccgccttgc caatggcgag atgctggagc cagaggggct actggcgctg      1200
     gtcaatgagt gtaatcccga acagggcggt caggagtttc tggatgactt gttctggcgc      1260
     ctgactcagg tcatgtcgcc tgaacacggg cttgaggatg atgtgtcggc aacgtttttc      1320
     gagtttaacg ggccgtga                                                    1338
//

If you have problems or comments...

PBIL Back to PBIL home page