(data stored in ACNUC9435 zone)

EMBL: CP000031.PE221

CP000031.PE221       Location/Qualifiers
FT   CDS_pept        244548..245786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0226"
FT                   /product="cytochrome P450 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0226"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93551"
FT                   /db_xref="GOA:Q5LX14"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX14"
FT                   /protein_id="AAV93551.1"
FT                   /translation="MTTRTPQNTHCVDMTTGSRAMSDAPVYEIDLAAFWADPYPDLKRM
FT                   RAEAPIAYVPQLGATLITRRDEIFAQEKRIEIFSSDQPQGLMTVLMGQNMMRKDGDAHM
FT                   AERKAIFPTVSPKTVKQVWVAQFRAAAQRVLDDLAPRGACDLVRDYAMPVSAEALKAIT
FT                   GLTNMTAAEMDRVSQGMIDGCANYAGDPLVEARCHDCTASIDAHIDAMIPVLDARPDHS
FT                   LLSVQRRAGLSDAQTRANIKLAISGGQNEPRDAIAGTAWAVLSHPDALARLQSGAVPWL
FT                   RAFEEYARWISPIGMSPRRVAQRATVQGVTLEPEDRVFLMFGSGNRDESVFANPDRFDL
FT                   DQDIAPAISFGAGPHFCAGAWASRALIGEVALPLLFERLPGLALDGEARFGGWAFRGPI
FT                   TVPVRWEPAPREG"
     atgacaacac gcactccaca gaatacccac tgtgttgaca tgacaacagg gagtcgcgcc        60
     atgtcggatg cacccgtcta cgagattgat ctggcggcct tctgggccga tccttatccc       120
     gatctgaaac ggatgcgggc cgaggcgccc atcgcctatg taccgcagct gggcgcgacg       180
     ctgatcaccc ggcgcgacga aatctttgcg caggagaaac ggatcgagat cttctcctcg       240
     gaccagccgc aggggctgat gacggtgctg atgggccaga acatgatgcg caaggatggg       300
     gatgcgcata tggccgagcg caaggcgatc tttcccaccg tctcgcccaa aacggtgaaa       360
     caggtttggg tcgcgcagtt ccgagccgct gcccagcggg tgctggacga tctggcgccg       420
     cgcggcgcct gcgacctggt gcgcgattat gccatgccgg tttcggccga ggcactcaag       480
     gcgatcaccg ggctgaccaa catgaccgcc gccgagatgg atcgggtgag ccagggcatg       540
     atcgacggct gcgccaatta cgcgggcgat cccctagtcg aggcgcgctg ccatgattgc       600
     accgcctcga tcgacgccca tatcgacgcg atgatcccgg tgctggatgc cagacccgac       660
     cattcgctgc tctcggtcca gcgccgcgcg gggctcagcg acgcgcagac ccgcgctaat       720
     atcaagctgg ccatttccgg cggccagaac gagccgcgcg atgccatcgc cggcaccgcc       780
     tgggcggtgc tcagtcaccc ggatgcgctg gcgcggctgc aatcgggcgc ggtgccctgg       840
     ctgcgcgcgt tcgaggaata tgcccgctgg atctcgccca tcggcatgtc gccgcgccgg       900
     gtggcgcagc gtgccacggt gcagggcgtg acgctggagc ccgaggaccg ggtgtttttg       960
     atgttcggat cgggcaatcg cgatgaaagc gtctttgcca atccggaccg cttcgatctg      1020
     gatcaggata tcgcaccggc gatctccttt ggcgccgggc cgcatttctg cgcgggggcc      1080
     tgggcgtcaa gggcgctgat cggagaggtg gcgttgccgc ttcttttcga acgattaccg      1140
     ggcctcgcgc tggacggcga ggcccggttc ggcggctggg ccttccgagg tccgatcacg      1200
     gtgccggttc gctgggaacc ggcaccgcgg gagggttga                             1239
//

If you have problems or comments...

PBIL Back to PBIL home page