(data stored in ACNUC9435 zone)

EMBL: CP000031.PE223

CP000031.PE223       Location/Qualifiers
FT   CDS_pept        247265..248473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0228"
FT                   /product="membrane protein, putative"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0228"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93553"
FT                   /db_xref="GOA:Q5LX12"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX12"
FT                   /protein_id="AAV93553.1"
FT                   /translation="MRPGHWAGRRTANPPFQPPAERRARPTRLLAENRSLVTAPGRFAT
FT                   PLSPPDKTGDSIRGEMERRQGKDTMTAADPNLSAGADQPEGATTLTGILFLLLATTIFP
FT                   IQDVIIKSLSSEFAVHQIVFWRSVFALPIAAAMALYEGSLWPWKIGSWPLQLTRAVAAF
FT                   SSYLVYYMALAAIGLAETAAITFSTPIFVTLLAAVFLGEKIGLWRWLAVFLGMAGVLVI
FT                   VQPGASVFEPAALLALAAALFYAISIIATRRLGNRTNGGTMTLVTLLVYIVGGTVLGLV
FT                   FSGLETASPHPSLAFLYRDWIAPAPMDWLALAALGVTSGIGFFALSQAYRMAEASVVTP
FT                   FEYTYLPWAVLWGYLVFGVLPVMSTWIGLTLIVGSGLLILFRETMRGRRIVRRRGLGVM
FT                   RQR"
     atgaggccgg ggcactgggc gggaaggcgc acggccaacc ccccgtttca gcctccggcg        60
     gagcgccgcg cgcggccaac ccgacttttg gcagaaaacc ggtcgttggt gaccgcgccg       120
     ggccggttcg cgacccctct gtcgcccccc gacaagaccg gcgattcgat ccggggcgaa       180
     atggagaggc gccaagggaa agatacgatg accgctgccg atccgaatct ctccgccggg       240
     gcggatcagc ccgagggcgc gaccacgctg accggcatcc tgttcctgct gctcgcgacc       300
     accatctttc cgattcagga tgtgatcatc aaaagcctga gcagcgaatt cgcggtgcat       360
     cagatcgtgt tctggcgctc ggtcttcgcc cttccgatcg ctgctgcgat ggcgctatac       420
     gaaggctcgc tctggccgtg gaagatcggc tcgtggccat tgcagttgac acgtgcggtg       480
     gcggccttct cgtcctatct ggtctattac atggcgctgg ccgccatcgg gctggccgaa       540
     accgccgcca tcaccttctc caccccgatt ttcgtcaccc tgctggcggc ggtatttctg       600
     ggcgagaaga tcggcctctg gcgctggctg gcggtgtttc tcggcatggc cggggtgctg       660
     gtgatcgtcc agccgggcgc gtcggtgttc gaaccggcgg cgctgctggc actggcggcg       720
     gcgctgttct acgcgatctc gatcatcgcc acgcggcgac tgggcaaccg caccaatggc       780
     ggcaccatga cgctggtgac cttgctggtc tacatcgtcg gaggcactgt gctgggactg       840
     gtgttctcgg ggctcgaaac cgcctcgccg cacccgagtc ttgcgtttct ctatcgcgac       900
     tggatcgcgc ccgcgccgat ggactggctg gcgctggcgg cgctgggggt gacctcgggc       960
     atcggcttct tcgcgctcag ccaggcctat cgcatggccg aggccagcgt ggtgactccg      1020
     ttcgaataca cctatctgcc ctgggcggtg ctatggggtt atctggtgtt cggggtgctg      1080
     ccggtgatgt ccacctggat cgggctgacg ctgatcgtcg gctcgggcct gttgatcctg      1140
     ttccgcgaga ccatgcgcgg ccgccgaatc gtccgccgcc gcggtctggg tgtcatgcgg      1200
     cagagatag                                                              1209
//

If you have problems or comments...

PBIL Back to PBIL home page