(data stored in ACNUC7421 zone)

EMBL: CP000031.PE227

CP000031.PE227       Location/Qualifiers
FT   CDS_pept        250710..251693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0232"
FT                   /product="quinone oxidoreductase, putative"
FT                   /note="identified by similarity to SP:P40783; match to
FT                   protein family HMM PF00107"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0232"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93557"
FT                   /db_xref="GOA:Q5LX26"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX26"
FT                   /protein_id="AAV93557.1"
FT                   /translation="MSETARTVVIEGFGGPEVLQLRDLPVGEPGPGELRIRHQACGLNF
FT                   IDVYQRTGLYPLALPHALGMEAAGIVEAVGEGVTHLKPGDRAAYAATPPGAYAQARVMP
FT                   AAQVCPLPDEISFDQAAAMMLKGLTVDYLFHRTTPLSRGDTVLFHAAAGGVGLIACQWA
FT                   KAEGITLIGTAGSDEKCALAKAHGATHVINYRTENFTDRVRELTDGKGVDVVMDSIGAD
FT                   TFEGSLDCLKPLGMMISFGNASGPVPPVNIGMLGQKGSLKLTRPTLFTHISDHAACQAM
FT                   ARRLFGKVTGGEVKIRIDQRFPLDQVADAHRALEARQTTGSTILEL"
     atgagcgaga ctgcaagaac cgtggtgatc gaggggtttg gcggccccga agtgctgcaa        60
     ctgcgcgatc tgccggtggg cgagccgggg cctggagagc tgcgcatccg gcatcaggcc       120
     tgcgggctga acttcatcga cgtctatcag cggaccgggc tctatcccct ggcgctgcct       180
     cacgcgctgg ggatggaggc ggccggcatc gtcgaggcgg tgggcgaggg ggtcacccat       240
     ctgaaaccgg gcgaccgggc cgcttatgcc gccacccctc cgggtgccta tgcccaagcg       300
     cgcgtcatgc ccgcagcaca ggtctgcccg ctgcctgacg agatctcctt tgatcaggcg       360
     gccgcgatga tgctcaaggg gttgacggtc gattacctgt tccatcgcac cacgcctttg       420
     tcacggggcg ataccgtgct gttccatgcg gcggcgggcg gggttggcct gatcgcctgc       480
     caatgggcca aagccgaggg gatcacgctg atcggcaccg ccggcagcga cgagaaatgc       540
     gcgctggcca aggcgcatgg cgccacccat gtcatcaatt accggaccga gaatttcact       600
     gatcgggtgc gcgagctgac agatggcaag ggcgtcgacg tggtgatgga ttcgatcggg       660
     gcagacacgt tcgaaggctc gctcgactgc ctgaaaccgc tgggcatgat gatttccttc       720
     ggcaatgcct cggggccggt gccgccggtc aatatcggca tgctcgggca aaagggcagt       780
     ctgaaactca cccgcccgac cctgttcacc catatttccg atcatgccgc ctgtcaggcg       840
     atggcgcggc ggctgtttgg caaggtgacc gggggtgagg tcaagattcg catcgaccag       900
     cgtttcccgc tcgatcaagt ggccgatgcc catcgcgcgc ttgaggcgcg ccagaccacc       960
     ggcagcacca ttctggaact gtag                                              984
//

If you have problems or comments...

PBIL Back to PBIL home page