(data stored in ACNUC7421 zone)

EMBL: CP000031.PE236

CP000031.PE236       Location/Qualifiers
FT   CDS_pept        260302..261231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0241"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0241"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93566"
FT                   /db_xref="GOA:Q5LX30"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX30"
FT                   /protein_id="AAV93566.1"
FT                   /translation="MNFKLRQLEAFRAVAQTGSITRAAQQLGISQPAASRLLADFSASV
FT                   EFPLFVREGGSMSPTPESRYMLAEINRVFEGLAHLEELRHNLKDRTAGHLRIACLPGFA
FT                   TSHLPRVLTAFLKDRPGVTVTLEPDRPERILEWIVGQQYDCAITDGFAGHPATESTDIA
FT                   IRTVCILPPGHPLSDRPEITPHDLRGEKIIHSRRDSPFFRRLAQAFTDSEVELSSWIEV
FT                   RQFTTACTIVAEGQGAAVLSALDAEQYRDRGLVIRPFVPRIAHRLSLLRPVTGSLSPLV
FT                   LDFLEAFTASLAPFIDHEERRANPVGAR"
     ttgaatttca agctgagaca gttggaggcc tttcgcgcgg tggcgcagac aggctcgatc        60
     acacgtgcag cgcagcaatt gggaatctcg caaccagccg ccagccgcct gcttgccgat       120
     ttctcggctt cggtcgagtt tccactgttc gtacgcgagg ggggcagcat gagcccgacc       180
     cccgaatcgc gctatatgct ggccgagatc aaccgggtgt tcgaggggct cgcccatctg       240
     gaagagctgc gtcacaatct caaggaccgc accgccgggc atctgcgcat cgcctgtctg       300
     cccggttttg ccaccagcca tctgcccagg gttctgaccg cgttcctgaa ggacaggccc       360
     ggcgtgaccg tcacgcttga acccgacagg cccgagcgca tcctggaatg gatcgtcggc       420
     cagcaatatg actgtgccat taccgacggc ttcgccggcc atccggcaac cgaaagtacc       480
     gatatcgcga tccgcaccgt ctgcatcctg cctccggggc atccgttgtc agatcgaccc       540
     gaaatcacgc cgcacgatct gcgcggcgag aagatcatcc attcccgccg cgacagcccg       600
     ttctttcgcc gcctggcgca ggcctttacc gatagcgaag tggagttgtc ctcgtggatc       660
     gaggtgcgcc agttcaccac cgcctgcacc atcgtggccg aggggcaggg ggcggcggtg       720
     ctgtcggcgc tggatgcgga gcagtatcgc gaccgcggcc tggtgatccg gccctttgtg       780
     ccccggatcg cccatcgcct gtcactgctg cgacccgtta ccggcagcct gtcgcctctg       840
     gtgctggatt tcctggaggc gttcacggcc agtctggctc cgttcatcga ccatgaggaa       900
     cgtcgggcga acccggttgg cgcacgctag                                        930
//

If you have problems or comments...

PBIL Back to PBIL home page