(data stored in ACNUC7421 zone)

EMBL: CP000031.PE245

CP000031.PE245       Location/Qualifiers
FT   CDS_pept        274505..274942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0255"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="identified by match to protein family HMM PF01047"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0255"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93575"
FT                   /db_xref="GOA:Q5LX34"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX34"
FT                   /protein_id="AAV93575.1"
FT                   /translation="MLDRALTLDELLCFSLYSANHAMGRLYRPLLARFDLTYPQYLVLV
FT                   ALWQRDGRKVSALGAELQLESNTLTPLLKRMEAAGLIRRARNPEDERSVIVTLTDKGRG
FT                   LEGEAAEISNCILAAADADIAELAELRDRLHRLTARLREAG"
     atgctggacc gcgccctgac cctcgacgaa ctgctttgtt tttcgctcta ttccgccaat        60
     cacgcgatgg ggcggctgta ccgtccgttg ttggcacggt tcgatctgac ctatccgcaa       120
     tacctggtgc tggtggcgct gtggcagcgg gatggccgca aggtgagcgc tctgggcgcg       180
     gaactgcagc ttgaatcgaa cacgctgacg ccgcttttga aacggatgga ggcagctggg       240
     ctgatcaggc gcgcgcgcaa ccccgaggat gagcgcagcg tgatcgtgac gctgaccgac       300
     aagggccgtg ggctggaggg cgaggcggcg gaaatctcga actgtattct ggcggcggcg       360
     gatgcggata tcgccgaact ggccgagctg cgcgaccggc tgcaccggtt gacggcgcgg       420
     ttgcgcgagg ccggatag                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page