(data stored in ACNUC7421 zone)

EMBL: CP000031.PE246

CP000031.PE246       Location/Qualifiers
FT   CDS_pept        complement(274955..275284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0256"
FT                   /product="copper-binding protein, plastocyanin/azurin
FT                   family"
FT                   /note="identified by match to protein family HMM PF00127"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0256"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93576"
FT                   /db_xref="GOA:Q5LX52"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR028096"
FT                   /db_xref="InterPro:IPR035668"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX52"
FT                   /protein_id="AAV93576.1"
FT                   /translation="MRLTRRQVCFGAGGAIVGSALPASGSTPVVVDIRSFVFEPAEITI
FT                   RAGETIVWINHDFAPHTATDDEVNWDTGELEKDAQAAIRFDTPGTYPYFCAYHPHMTGT
FT                   VIVTA"
     atgcggctaa cccgcagaca ggtctgcttc ggtgcggggg gggcgatcgt gggttccgcc        60
     cttcccgcat cgggctctac cccggtggtg gtcgatatcc ggtcctttgt gtttgaaccg       120
     gccgagatca ccatccgcgc gggcgagacg attgtctgga tcaaccacga cttcgcgccg       180
     cataccgcca ccgatgacga ggtgaattgg gataccggcg agttggaaaa ggacgcacaa       240
     gccgcgatcc gtttcgacac acccggcacc tatccctatt tctgcgccta tcatccccac       300
     atgaccggga cggtcatcgt gaccgcctga                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page