(data stored in ACNUC7421 zone)

EMBL: CP000031.PE247

CP000031.PE247       Location/Qualifiers
FT   CDS_pept        complement(275275..275799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0257"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to PIR:A96030"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0257"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93577"
FT                   /db_xref="GOA:Q5LX51"
FT                   /db_xref="InterPro:IPR025419"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX51"
FT                   /protein_id="AAV93577.1"
FT                   /translation="MKTLTLAAAIAVGFVAQSASAADKMNDLEIAHTAYTAGQLDIRYA
FT                   HLALAVSDNAEVRAFAETMIRDHTAVNAAAGDLITKLNVTPQDNDLSRTLVKGAADKRA
FT                   ELISLSGKAFDCAYAQNELGYHQVVNKTVEGVFIPAVTVEPLKDLLSDALVTFKVHEGH
FT                   AEQMVNGLQCG"
     atgaaaaccc ttactctcgc cgccgccatc gccgtcggtt ttgtcgcgca atcggcctcc        60
     gccgccgaca agatgaatga cctcgagatt gcacataccg catataccgc cggtcaactc       120
     gacatccgct atgcgcatct ggcgctggcc gtgtccgaca atgccgaggt gcgcgcattc       180
     gccgaaacca tgatccgcga ccataccgcg gtgaacgcgg ccgccggcga cctgatcacc       240
     aagctgaacg tcaccccgca ggacaacgac ctgagccgca cgctggtcaa gggcgctgcc       300
     gacaagcggg ccgaactgat atcgctgagc ggcaaggcgt ttgactgcgc ctatgcccag       360
     aacgaacttg gctaccacca ggtggtcaac aagacggtcg aaggcgtgtt catccccgcc       420
     gtgaccgttg aaccgctcaa ggatctgctg tccgacgcgc ttgtcacctt caaggtgcac       480
     gaaggccatg ccgagcagat ggtgaacggc ctgcaatgcg gctaa                       525
//

If you have problems or comments...

PBIL Back to PBIL home page