(data stored in ACNUC9435 zone)

EMBL: CP000031.PE248

CP000031.PE248       Location/Qualifiers
FT   CDS_pept        275937..276917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0258"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="identified by match to protein family HMM PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0258"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93578"
FT                   /db_xref="GOA:Q5LX50"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR032783"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX50"
FT                   /protein_id="AAV93578.1"
FT                   /translation="MLDLLSDILTRLSLKGTLYFRTSFTPPFGVHVPSYQNVARFHFAY
FT                   RGECMVHVPAANETLRLTQGDLVLIPHGAEHMLMCQHSRPDSALPLDTVLSRSGYRGEG
FT                   VLVYGGDEEDQDTQLICGHLTYGMHGRSCPGHTLLERLPPYILIRDYGEERGVWLEATL
FT                   RVIAAEAGRDRMGSDLIALKMTEALFAQAIRAHLETVSPDDGALAGFADPNLSRALSAF
FT                   HREPAKDWTVEGLARIAGQSRTGFAQHFAAKMGMTPMQYLTSWRMQIACEGLVDSRLSV
FT                   ADAAELAGYASEAAFSRVFRKQLGVSPAAYRQQFESAKRQALAAS"
     atgttggacc tgctcagcga tatcctcacc cgcctgtccc tgaaggggac gctgtatttc        60
     cgcacgtcgt tcacaccgcc gttcggggtg cacgtgccct cgtatcagaa cgtggcccgg       120
     tttcacttcg cctatcgcgg cgaatgcatg gtgcatgtgc cggcggctaa cgagacgctg       180
     cggctgactc agggcgatct ggtactgatc ccgcacgggg ccgagcacat gctaatgtgc       240
     cagcattcgc gccccgattc ggcgttgccg ctggatacgg tgctcagccg gtcgggctat       300
     cgcggcgagg gggtgctggt ctatggcggt gacgaggaag atcaggacac gcagctgatc       360
     tgcgggcatc tgacctatgg catgcatggc cggtcctgcc cgggccatac gctgttggag       420
     cgtctgccgc cctatatcct gatccgcgat tacggcgagg agcgtggcgt ctggctggag       480
     gcaactttgc gggtgatcgc ggccgaggcg gggcgcgatc ggatgggcag cgacctgatc       540
     gcgctgaaga tgaccgaggc gctgtttgct caggcgatcc gcgcacatct ggaaacggtt       600
     agcccggatg acggggcgct ggctgggttc gccgatccca acctgtcgcg ggcgctgagc       660
     gcctttcacc gcgaacccgc caaggattgg acggtcgagg ggctggcccg gatcgcgggc       720
     cagtcgcgca ccggctttgc tcagcatttc gccgccaaga tgggcatgac cccgatgcaa       780
     tacctgacct cgtggcggat gcagatcgcc tgcgaggggc tggtcgacag ccggttgagc       840
     gtggccgatg ccgccgaact ggccggctat gcctcggaag cggcgttcag ccgggtgttc       900
     cgcaagcagc ttggggtgtc tccggcggcc tatcggcagc agtttgagag tgcgaaacga       960
     caggcattgg ccgcatcttg a                                                 981
//

If you have problems or comments...

PBIL Back to PBIL home page