(data stored in ACNUC7421 zone)

EMBL: CP000031.PE25

CP000031.PE25        Location/Qualifiers
FT   CDS_pept        23831..24427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0025"
FT                   /product="hydrolase, NUDIX family"
FT                   /note="identified by match to protein family HMM PF00293"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0025"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93356"
FT                   /db_xref="GOA:Q5LWH6"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWH6"
FT                   /protein_id="AAV93356.2"
FT                   /translation="MTDPIDSLMAALARTGPGSSDFDLNPGTILPEGRRLRPAGVLVPV
FT                   TLAHGAPRVILTKRSSALKHHPGQIAFPGGKQDEGDADVIAAALREAEEEIGLTRTLPQ
FT                   VLGTLPAHETVTAFTVTPVVAVVERTFDVRPEPGEVEEVFSVPLAHLMRPENYSVQSRR
FT                   WRGQRRHYFTVPFGPYYIWGATARMLRGLAERMQQ"
     gtgactgatc cgatcgacag tttgatggcg gccctggccc ggaccgggcc tgggtcgagc        60
     gactttgacc tcaacccggg caccattcta cccgaggggc gcaggctgcg ccccgccggg       120
     gtgctggtgc cggtgacgct ggcccacggt gcgccccggg tgatcctgac caagcggtcc       180
     tcggcgctga aacatcatcc gggtcagatc gcctttcccg gcggcaaaca ggacgagggc       240
     gacgcggatg tgatcgccgc cgccctgcgc gaggccgagg aagagatcgg tctgacccgc       300
     accctgccgc aggtgctggg caccctgccg gcgcatgaga cggtgaccgc ctttaccgtc       360
     acgcctgtgg tggcggtggt cgagcgcacc ttcgacgtcc ggcccgagcc gggcgaggtc       420
     gaagaggtgt tcagcgtgcc gctcgcacat ctgatgcggc ccgagaacta ctcggttcag       480
     tcgcgccgct ggcgcggaca gcggcggcat tacttcaccg tgcctttcgg gccctactac       540
     atctggggcg ccaccgcgcg gatgctgagg gggctggccg aaaggatgca gcaatga          597
//

If you have problems or comments...

PBIL Back to PBIL home page