(data stored in ACNUC9435 zone)

EMBL: CP000031.PE250

CP000031.PE250       Location/Qualifiers
FT   CDS_pept        277569..279137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0260"
FT                   /product="alkaline phosphatase, putative"
FT                   /note="identified by similarity to SP:P42251; match to
FT                   protein family HMM PF00245; match to protein family HMM
FT                   TIGR01409"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0260"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93580"
FT                   /db_xref="GOA:Q5LX48"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008963"
FT                   /db_xref="InterPro:IPR018946"
FT                   /db_xref="InterPro:IPR032093"
FT                   /db_xref="InterPro:IPR038607"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX48"
FT                   /protein_id="AAV93580.1"
FT                   /translation="MTRLLRPSRRAFLAGGTAFTATLAMPSISRAASRPVFTHGVQSGD
FT                   VDTMSGMIWTRTDRPAKVMMEVSSTESFADARRLSPMFATPESDFAVKRLVDNLPADQE
FT                   VFYRFVAADLDDISAVSEPLMGRFRTAPTARRDIRFAWSGDTAGQGWGIDDEGMRTYAT
FT                   MAQHQPDFFIHSGDTIYADGPMKDEVEKDGAVIWKNTTLIDEKRKVAETLAEFRGQWKY
FT                   NLMDEHVQAMNALCPTFFQWDDHEVVNNWSDAKDLSADDRYTEKSVHVLQSRAARAFHE
FT                   MTPLRITPAEPGRVYRKISYGPMLDVFFLDLRSYRGPNGASMEDEITDQSRILGAEQLA
FT                   WIKRELAASTATWKVIASDMPIGLIVWDNWKEKAGAEAISNGDHGPAKGRELEIADLLR
FT                   FIKSAGVRNTVWFTADVHYTAAHHYSPERAQFQDFDPFWEFVSGPLHAGTFGPNDLDRT
FT                   FGPEVKFVKAPTPEQGVNLPPSMGLQFFGLVDIDAASQQMKVRLMDRGNTELWSVTLDP
FT                   VLSAI"
     atgacacgac ttcttcgccc ctcgcgccgg gcctttctgg cgggcggcac cgcctttacc        60
     gccacgctgg ccatgccctc gatcagccgc gccgcctcgc gcccggtctt tacccatggg       120
     gtgcagtccg gtgacgtcga caccatgtcg ggcatgatct ggacccgcac cgaccgcccg       180
     gcaaaggtga tgatggaagt gtcgagcacc gagagctttg ccgacgcgcg ccgcctgtcg       240
     ccgatgttcg ccacgcctga gagcgatttt gccgtcaagc ggctggtcga taacctgccc       300
     gccgatcagg aggtgttcta tcgctttgtc gccgccgatc tggacgatat cagcgcggtg       360
     tccgaacccc tcatgggacg gttccgtaca gcgccgaccg cccggcgcga catccgcttt       420
     gcctggtcgg gtgataccgc cggccagggc tggggcatcg acgacgaggg catgcgcacc       480
     tatgccacga tggcgcagca ccagcccgat ttctttatcc attccggtga cacgatctat       540
     gccgatggcc cgatgaagga cgaggtcgaa aaggacggcg cggtgatctg gaagaacacc       600
     accctgatcg acgaaaagcg caaggtggcc gagacgctgg ccgagttccg tggccagtgg       660
     aaatacaacc tgatggacga acatgtgcag gcgatgaacg cgctttgccc gacgtttttc       720
     cagtgggacg atcacgaggt ggtcaacaac tggtcggacg ccaaggacct gagcgccgac       780
     gaccgctata ccgagaaatc ggtgcatgtg ctgcaaagcc gtgctgcgcg ggccttccac       840
     gagatgacgc cgctcaggat tacgcctgcc gagccgggcc gggtctatcg caagatatcc       900
     tatggcccga tgctggatgt gttcttcctt gacctgcgca gctatcgcgg cccgaacggt       960
     gcctcgatgg aggacgagat caccgatcag agccgcattc tgggggcgga gcaactggcc      1020
     tggatcaagc gggaactggc agcctcgacc gcgacctgga aggtgatcgc ctcggacatg      1080
     cccatcgggc tgattgtctg ggataactgg aaggaaaagg caggcgccga ggcgatctcg      1140
     aacggcgatc acggccccgc caaggggcgc gagctggaga tcgccgatct cctgcgcttc      1200
     atcaagagcg cgggcgtgcg caacacggtc tggttcacgg ccgatgtgca ttacaccgcc      1260
     gcgcatcact acagtccgga gagggcgcag ttccaggact tcgatccgtt ctgggaattt      1320
     gtctcgggcc cgctgcatgc cgggaccttc ggccccaacg atctggaccg gacctttggc      1380
     cccgaggtga agttcgttaa ggcaccgacg ccggagcagg gggtgaacct gccgcccagc      1440
     atgggtctgc agttctttgg tctcgtggat atcgacgcgg ccagccagca gatgaaggtc      1500
     cgcctgatgg atcgcggcaa taccgagctg tggtcggtca cgctcgaccc ggttctgtcg      1560
     gcaatctga                                                              1569
//

If you have problems or comments...

PBIL Back to PBIL home page