(data stored in ACNUC7421 zone)

EMBL: CP000031.PE255

CP000031.PE255       Location/Qualifiers
FT   CDS_pept        complement(283122..284063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0265"
FT                   /product="auxin efflux carrier family protein"
FT                   /note="identified by similarity to GB:AAA99820.1; match to
FT                   protein family HMM PF03547"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0265"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93585"
FT                   /db_xref="GOA:Q5LX43"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX43"
FT                   /protein_id="AAV93585.1"
FT                   /translation="MSQILTITFPIYAALAVGFLVVRQGWFSSADMRVLGRYVMDIALP
FT                   ALLFNAVASRDVAEVFHPGYMLAFAAAGLATVALSYLWFTLTGTEARRRAVAVMGSSCP
FT                   NSGFVGYPVMLLTFPDLAGVILALNMLVENVLIIPACLILTDMARGRGQGGIGQRIAGI
FT                   LWGVLKRPMVIGLLLGLAVSLAGVPVPQTVTRLMQMLAASASALALVVIGGSLAGLSWK
FT                   GSRWHAVQISALKLLLHPALALLAVILVAAIGLPLDPDMGTALILSAAMPMFGIYAVLA
FT                   QELGHEGMASIALLTATTLAFFTLSGLLWWLT"
     atgagccaga tcctgaccat caccttcccg atctacgccg cacttgcggt cgggtttctg        60
     gtggtccgac agggttggtt cagcagtgcc gatatgcggg ttctgggccg ctacgtgatg       120
     gatatcgccc tgcccgcgct cctcttcaac gcggtggcca gccgcgacgt ggccgaggtg       180
     ttccaccccg gctatatgct ggcctttgcc gccgccggcc ttgccactgt cgcgctcagc       240
     tatctgtggt tcacgctcac gggcaccgag gcccgccgcc gcgccgtggc ggtgatgggc       300
     agttcctgcc ccaattccgg ctttgtcggc tatccggtga tgctgctcac ctttcccgat       360
     ctggcgggcg tgatcctggc gctgaacatg ctggtcgaaa acgtgctgat catccccgcc       420
     tgcctgatcc tgacggacat ggcgcgtgga cgcggtcagg gcggcatcgg ccagcggatc       480
     gcgggcatcc tctggggcgt tctgaagcgc ccgatggtga tcggtctgct gctgggcctc       540
     gcggtcagcc tcgccggtgt gcccgtgccg cagaccgtga cccggctgat gcagatgctg       600
     gccgcctccg cctcggcgct ggcgcttgtg gtgatcggcg gctctctggc cgggctcagc       660
     tggaaaggca gccgctggca tgccgtacag atctcggcgc tgaaactgct gctgcacccg       720
     gcgctggccc ttctggcggt catcctggtc gccgctatcg gcctgccgct tgatcccgac       780
     atgggcaccg cgttgatcct gtcggcggcg atgccgatgt tcggcatcta cgccgttctt       840
     gcgcaggaat tggggcacga gggcatggcc tcgatcgccc tgctcacggc aacgacgctg       900
     gccttcttta ccctctccgg cctgctctgg tggctgacct ga                          942
//

If you have problems or comments...

PBIL Back to PBIL home page