(data stored in ACNUC9435 zone)

EMBL: CP000031.PE259

CP000031.PE259       Location/Qualifiers
FT   CDS_pept        286691..287305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0269"
FT                   /product="negative transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF04299"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0269"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93589"
FT                   /db_xref="GOA:Q5LX58"
FT                   /db_xref="InterPro:IPR007396"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX58"
FT                   /protein_id="AAV93589.1"
FT                   /translation="MHPNPAFRGESVARNLEFARDRGFGVLAVAVDGAPLISHVPFLVS
FT                   GDGSEVELHLVRSNPIVQALKSPLPARIAVSGPDGYISPDWYGVADLVPTWNYVAVHLA
FT                   GELDLRPESELPGLLDRLSARFEKQLLPKPAWTRAKMTPGAFDRMLRMIVPCRMRVSDV
FT                   QGTWKLGQNKPEAARMGAAEGVAASTIGTELETLAVLMRGA"
     atgcatccca acccggcatt tcgcggcgaa agcgtggcac gtaatctgga atttgcccgc        60
     gaccggggct ttggcgtgct ggccgtggcg gtggacggcg cacccctgat cagccatgtg       120
     ccgtttctgg tgtccggcga tggcagcgag gtcgagttgc atctggtgcg ttccaacccg       180
     atcgtgcagg cactcaaatc gccgctcccg gcgcggatcg ccgtaagcgg gcccgacgga       240
     tatatctcgc ccgattggta cggggtggcg gacctggtgc cgacctggaa ctatgtcgcg       300
     gtgcatctgg cgggtgagtt ggatctgcgg cccgagagcg agttgccggg cctgctggac       360
     cgtctctcgg cccggttcga gaagcagctc ttgcccaagc ccgcctggac ccgtgccaag       420
     atgacacccg gtgcgtttga tcggatgttg cgtatgatcg tgccctgccg gatgcgtgtt       480
     tcagatgtac agggcacctg gaagctgggg cagaacaagc ccgaggcggc gcggatgggt       540
     gcggccgagg gggttgcggc aagcaccatc ggcaccgagc tggaaacgtt ggccgtattg       600
     atgcgggggg cttga                                                        615
//

If you have problems or comments...

PBIL Back to PBIL home page