(data stored in ACNUC9435 zone)

EMBL: CP000031.PE26

CP000031.PE26        Location/Qualifiers
FT   CDS_pept        24424..25578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0026"
FT                   /product="polyA polymerase family protein"
FT                   /note="identified by match to protein family HMM PF01743"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0026"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93357"
FT                   /db_xref="GOA:Q5LWH5"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWH5"
FT                   /protein_id="AAV93357.1"
FT                   /translation="MTRIDEAWLTEPATQQVCRALTEGGAQALFVGGCVRNALLGAPVS
FT                   DIDITTDAHPERVMALAAAAGIKAVPTGIAHGTVTLVANSIPHEVTTFRRDVETDGRRA
FT                   VVAFSDSIHEDAARRDFTMNALYARPDGTVLDPLDGLPDLQARRVRFIGDATDRIREDY
FT                   LRSLRYFRFHAWYGDAEAGFDAEALAAIAGNLDGLSRLSRERVGAEMLKLFAAPDPAPS
FT                   VAAMRAAGVLAQLLPGADDRALAPLVHLEDGLGADPIRRLAALGDGEALASLRLSKAQM
FT                   ALLDTLRRAALGTAGAGELGHELGVEAARDALLLRAALLEQPLDPHAPAAIARGAAAVF
FT                   PVTARDLMPAYSGPALGARLATLKARWIASDFSLSRAALLVDKD"
     atgacccgga ttgacgaggc atggctgacc gaaccggcga cgcaacaggt gtgccgggcc        60
     ctgaccgagg gcggtgcgca ggcgctgttc gtcggtggct gtgtgcgcaa cgcactgttg       120
     ggcgcgccgg tcagcgatat cgacatcacc accgacgccc atcccgagcg ggtgatggcg       180
     ctggccgccg cggccgggat caaggcggtt cccacaggca tcgcccatgg caccgtgacg       240
     ctggttgcca atagcattcc gcatgaggtc accacttttc gccgcgatgt ggaaaccgac       300
     ggccgccgcg cggtggtcgc cttttccgac tcgatccacg aggatgccgc gcggcgcgat       360
     ttcaccatga acgcgcttta tgcccggccc gacggcacgg ttctggaccc gttggatggg       420
     ctgcccgatc tacaggcgcg gcgcgtgcgg ttcatcggtg atgcgaccga ccgcatccgc       480
     gaggattact tgcgctcgct gcgttatttc cggtttcacg cctggtatgg cgatgccgag       540
     gccggtttcg atgccgaagc gctggcggcg attgccggta atctcgacgg gctgtcccgc       600
     ctctcgcgcg agagggtggg ggccgagatg ttgaaactgt tcgccgcgcc cgacccggcg       660
     ccctcggtcg ctgccatgcg cgccgccggg gtgctggccc agcttctgcc cggtgcggat       720
     gatcgggcgc tggcgccgct ggtacatctg gaagacgggt tgggggccga tccgatccgg       780
     cggctggccg cgctgggcga cggcgaagca ctggcctcgc tccggttgag caaggcgcag       840
     atggcgttgc tggacacgct gcgccgagct gctttgggca ccgccggggc cggagagttg       900
     gggcacgaac tgggcgtcga ggcggcgcgc gatgcacttc ttctgcgggc cgcgctgctg       960
     gaacaaccgc ttgacccgca cgcgcccgcc gccattgcgc gcggggctgc ggcggtgttt      1020
     ccggtcactg cccgcgatct gatgccagcc tattctggcc ccgcgctggg cgcgcggctt      1080
     gccacgctaa aggcgcgctg gatcgcctcg gacttcagcc tgagcagggc ggctttgctg      1140
     gttgacaagg attga                                                       1155
//

If you have problems or comments...

PBIL Back to PBIL home page