(data stored in ACNUC7421 zone)

EMBL: CP000031.PE264

CP000031.PE264       Location/Qualifiers
FT   CDS_pept        291065..291460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0274"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:BAC74098.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0274"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93594"
FT                   /db_xref="GOA:Q5LX53"
FT                   /db_xref="InterPro:IPR025711"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX53"
FT                   /protein_id="AAV93594.1"
FT                   /translation="MRRAFRPISRRLFRRSKPRSHGSGAGCMASFGTDGGWSACRNFRR
FT                   CPMKPFALIAALALAASPVLALDLTTDTQLGSTPDEIRTSLKDLGYDVRKIEDEDGKIE
FT                   AYVVKDGKMAEVYVDPKTGKISKIEME"
     ttgcggcgag cgttcagacc catcagcagg cgcttattta ggcgcagtaa gccccgttcc        60
     catggcagcg gggccgggtg catggccagt ttcgggacag acggcggatg gtccgcctgt       120
     cgcaacttca ggagatgtcc catgaaaccc tttgccctga tcgccgcact cgccctggcc       180
     gccagtccgg ttctggccct tgatctcacc accgacaccc agctgggcag caccccggac       240
     gagatccgca ccagcctgaa agacctgggc tacgacgtcc gcaagatcga ggacgaggac       300
     ggcaagatcg aggcctatgt ggtcaaggac ggcaagatgg ccgaggtcta tgtcgacccc       360
     aagaccggca agatcagcaa gatcgagatg gagtga                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page