(data stored in ACNUC7421 zone)

EMBL: CP000031.PE266

CP000031.PE266       Location/Qualifiers
FT   CDS_pept        292054..292551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0276"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="identified by match to protein family HMM PF00196"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0276"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93596"
FT                   /db_xref="GOA:Q5LX68"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX68"
FT                   /protein_id="AAV93596.1"
FT                   /translation="MRPGDADERRAAILAWMIVLQALCALFFIGDVLADLRAGNDDTGT
FT                   HLWLEGSVALVLCIGLGVLMYELRQLLMRMERVTTTLRAARGEMAEVIEGFFADWGLTP
FT                   AERDVALMILKGLDNDSIATVRGRAAGTVRAQSAAIYAKAGVDGRTQFLSLFMEELLAD
FT                   PD"
     atgcggcccg gcgacgcgga tgagcgccgg gccgcgatcc tggcctggat gatcgtgttg        60
     caggccctgt gcgccctgtt cttcatcggt gatgtgctgg ccgatctgcg cgccgggaat       120
     gacgacacgg gcacccacct ttggctggag gggagcgtgg cgctggttct gtgcatcggg       180
     ctgggcgtgc tgatgtacga gctgcgccag ttgctgatgc ggatggaacg cgtcaccacc       240
     accctgcgcg cggcacgagg cgagatggcc gaggtgatcg agggcttctt tgccgattgg       300
     gggctgacac ctgcggagcg cgatgtggcg ctgatgatcc tcaaggggct ggacaatgac       360
     agcattgcca ccgtccgggg aagggctgcc ggaactgtgc gggcgcaatc ggcggcgatc       420
     tatgcaaagg cgggggtcga tgggcggacc cagttcctca gcctgttcat ggaagagctg       480
     ctggctgatc cggattag                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page