(data stored in ACNUC7421 zone)

EMBL: CP000031.PE27

CP000031.PE27        Location/Qualifiers
FT   CDS_pept        25770..27608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0027"
FT                   /product="ABC transporter, transmembrane ATP-binding
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF00664"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0027"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93358"
FT                   /db_xref="GOA:Q5LWH4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWH4"
FT                   /protein_id="AAV93358.1"
FT                   /translation="MFRFFENLVDPFVAYDETDTPPTRLWPFMLDYSQPFLRVFVWTAL
FT                   LSIIVAGVEIGLIYYMGRVVDVLNGEPAEVWARYGTEFIVLALFVLLIRPALHVADVLL
FT                   LNNAILPNFGTLIRWRAHKHVLRQSVGWFENDFAGRIANRIMQTPPAAGEVIFQVFDAI
FT                   SFSLAYLLGAAILLMAADIRLLLPLLIWFALYALLVRWTIQRVGPASQAASDARSTVTG
FT                   RVVDSYTNIHSVKMFAHDDRELTYAREAIEETRRTFQVEMRIFTIMDVVLVTLNGLLIV
FT                   GVVGWAIALWMQGQASVGLVAAASALTLRLNAMTGWIMWALTSFFRQLGVVAEGMETIA
FT                   QPIDLVDAPDARPLELSEGRIELQQLSHHYGRGAGGLDQLDLTIAPGEKIGLIGRSGAG
FT                   KSTLVKLLLRFYDPDSGRILIDGQDIARVTQNSLRSHIGMVQQDSALLHRSVRDNLLYG
FT                   RPDASEDEMIAAAKQAEAHDFILDLEDPQGRRGYDAHVGERGVKLSGGQRQRVTLARVI
FT                   LKNAPILLLDEATSALDSEVEAAIQDTLYGMMEGKTVIAIAHRLSTIAQMDRILVLDQG
FT                   RIVEEGDHADLLAQGGLYAQFWARQSGGFLNTEAAE"
     atgtttcgct ttttcgaaaa tcttgtcgat ccctttgtcg cctatgacga gaccgacacg        60
     ccgcccaccc ggttgtggcc ctttatgctg gattactccc agccgtttct gcgcgtcttt       120
     gtctggactg cgctgctgtc gatcatcgtc gccggggtcg agatcgggct gatctactac       180
     atgggccgtg tcgtcgatgt gttgaacggc gaaccggccg aggtctgggc gcgctacggc       240
     accgagttca tcgtgctggc actgttcgtc ctgctgatcc ggcctgcgct gcatgtggcc       300
     gatgtgctgc tgttgaacaa tgcgatcctg cccaatttcg gcaccctgat ccgctggcgc       360
     gcgcataaac acgtattgcg ccagtcggtc ggctggttcg agaatgattt tgccgggcgc       420
     atcgccaacc ggatcatgca gacccccccg gcggcgggcg aggtgatctt tcaggttttc       480
     gacgcgatct cgttttcgct ggcctatctg ttgggcgcgg cgatcttgct tatggcggcc       540
     gacatccggc tgctgctgcc attgctgatc tggttcgcgc tttatgcttt gctggtgcgc       600
     tggacgatcc agcgggttgg gccagcgtcg caggcggcct cggatgcgcg ttcgaccgtg       660
     acggggcggg tggtggacag ctataccaac atccattcgg tcaagatgtt cgcccatgac       720
     gaccgcgagc tgacctatgc ccgcgaagcg atcgaggaaa cgcgccgcac ctttcaggtg       780
     gaaatgcgga tctttaccat catggacgtg gtgctggtca ccctgaacgg gctgctgatc       840
     gtcggcgtgg ttggctgggc catcgcgctc tggatgcagg ggcaggccag tgtcggcctg       900
     gtggccgcag cctcggccct gaccctgcgg ctgaacgcga tgaccggctg gatcatgtgg       960
     gcgctgacca gtttctttcg ccaattgggt gtggtggccg aggggatgga aaccatcgcc      1020
     cagcccatcg acctggtgga tgcgccggat gcccggccgc tggagctgag cgagggccgg      1080
     atcgaactgc aacagctgtc gcatcactat gggcgcggcg ccggcgggct ggaccagttg      1140
     gacctgacaa ttgcgccggg tgaaaagatc gggctgatcg gacgctcggg cgcgggcaag      1200
     tcgacgctgg tcaagctgct gctccggttc tacgaccccg atagcggtcg catcctgatc      1260
     gacggacagg atatcgcccg ggtgacccag aacagtctgc gcagccatat cggcatggtg      1320
     cagcaggaca gcgccctgtt gcaccgctcg gtccgtgaca acctgcttta tggtcgtccc      1380
     gacgcgagtg aggacgagat gatcgccgcc gccaaacagg ccgaggcgca tgacttcatc      1440
     ctggacctcg aagatccgca gggcaggcgc ggctatgatg cccatgtggg cgagcgcggc      1500
     gtcaagctga gcggcgggca acgccagcgg gtgaccctgg cgcgggtcat tctgaagaac      1560
     gcgcccattt tgctgttgga cgaggcgacc agcgcgctag attccgaggt cgaggccgcc      1620
     attcaggaca cgctctacgg catgatggaa ggaaagaccg tgatcgccat cgctcaccgg      1680
     ctgagcacaa tcgcccagat ggaccgtatc ctggtgctgg atcagggccg gatcgttgaa      1740
     gagggcgatc atgccgacct gctggcgcag ggcgggctct atgcccagtt ctgggcacgg      1800
     caatcgggcg ggtttctgaa caccgaggcc gctgaatga                             1839
//

If you have problems or comments...

PBIL Back to PBIL home page