(data stored in ACNUC7421 zone)

EMBL: CP000031.PE270

CP000031.PE270       Location/Qualifiers
FT   CDS_pept        complement(295450..295923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0281"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:BAC93558.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0281"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93599"
FT                   /db_xref="GOA:Q5LX64"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX64"
FT                   /protein_id="AAV93599.1"
FT                   /translation="MNTLKSFIGGVALSLTLAGSAMAAGVDLNASSTGLALQGYDPVAY
FT                   FTVGEATEGDWKITAVYDDATYRFANAENKATFEANPEAYLPAYGGYCAFGAAMGFKFD
FT                   GDPDNWKIVDDKLYLNLSDEIQAKWEEDVPGFIVKANANWTDIADKAPAELQN"
     atgaacactc tcaaatcctt catcggcggc gtcgccctgt cgctgacgct ggccggttcg        60
     gccatggcag ccggtgtcga cctgaacgcc agctcgaccg gtctggcact gcaaggctat       120
     gacccggtgg cctatttcac cgtgggcgaa gccactgaag gcgactggaa gatcaccgcg       180
     gtctatgatg atgctaccta tcgctttgcc aacgccgaga acaaggcgac gttcgaggcg       240
     aacccggaag cctatctgcc ggcttatggc ggttactgcg cctttggcgc cgcgatgggc       300
     ttcaaatttg atggcgaccc ggacaactgg aagatcgtcg acgacaagct gtacctgaac       360
     ctgtccgacg agatccaggc caagtgggaa gaggacgtcc ccggtttcat cgtgaaggcc       420
     aacgccaact ggaccgacat cgccgacaag gccccggccg aactgcaaaa ctga             474
//

If you have problems or comments...

PBIL Back to PBIL home page