(data stored in ACNUC7421 zone)

EMBL: CP000031.PE273

CP000031.PE273       Location/Qualifiers
FT   CDS_pept        complement(296987..298276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0284"
FT                   /product="dihydroorotase, multifunctional complex type"
FT                   /EC_number="3.5.2.3"
FT                   /note="identified by similarity to SP:P46538; match to
FT                   protein family HMM PF01979; match to protein family HMM
FT                   TIGR00857"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0284"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93602"
FT                   /db_xref="GOA:Q5LX78"
FT                   /db_xref="InterPro:IPR004722"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX78"
FT                   /protein_id="AAV93602.1"
FT                   /translation="MSNILFTNARLIDPEAGTDRIGWLRVTGGRIVATGEDSPQGLEEP
FT                   PAETLDCGGKCLAPGIVDIGVKVGEPGERHKESYKSAGQAAAAGGVTTIITRPDTNPAI
FT                   DTPEALEFVTRRAQADTPVNVLPMAALTKGRQGREMTEIGFLLDAGAVAFTDCDHVVTN
FT                   TKVFSRALTYAKSCGALVIAHPQDPGLSEGAAATSGKFAALYGLPAVSPMAERMGLDRD
FT                   IALLEMTGAKYHADQITTARALPALERAKKNGLDITAGTSIHHLTLNELDVSGYRTFFK
FT                   VKPPLRSEDDRQAVIEAVRTGLIDTISSMHTPQDEESKRLPFEEAASGAVALETLLPAA
FT                   LRLYHAGQLDLPTLFRAMALNPARRLGLASGRLGAGAPADLVLFDPDVPFVLDRFTLKS
FT                   KSQNTPFDGQRMQGRVLATYVAGQAVYRRD"
     atgagcaaca tccttttcac caatgcccgg ctgatcgatc ccgaggccgg caccgaccgg        60
     atcggctggt tgcgtgtcac tgggggccgg atcgtggcaa ccggcgagga cagcccgcaa       120
     gggctggagg agccgcctgc cgaaaccctc gattgcggcg gcaaatgcct ggcccccggt       180
     atcgtcgata tcggggtcaa ggttggcgag ccgggcgagc gccacaagga gagctacaag       240
     tcggcaggac aggcggcggc ggcgggcggt gtcaccacca tcatcacccg gcccgacacc       300
     aatccggcca tcgacacgcc cgaggcgctg gaattcgtca cccgccgggc acaggccgat       360
     acgccggtca acgtgctgcc gatggcggcg ctgaccaagg gacggcaggg ccgcgagatg       420
     accgagatcg ggttcctgct ggatgcaggc gcggtggcct tcaccgattg cgaccatgtg       480
     gtcaccaata ccaaggtgtt ttcccgcgct ctgacctatg ccaaatcctg cggcgcgctg       540
     gtcatcgccc atccgcagga cccggggctg agcgaggggg cggcggccac cagcggcaag       600
     ttcgcggcgc tttatggcct gcccgccgtc tcgccgatgg cggaacggat gggactggat       660
     cgcgatatcg cccttctgga gatgacgggc gcgaaatacc acgccgacca gatcaccacc       720
     gcacgcgccc tgcccgcgct ggaacgcgcc aagaagaatg ggctggacat caccgccgga       780
     acctcgatcc accatctgac cctgaacgag ctggatgtgt cgggctatcg cacctttttc       840
     aaggtcaaac cgcccctgcg cagcgaggat gaccggcagg cggtgatcga ggcggtgcgc       900
     accggcctga tcgacacgat cagttccatg cacacaccgc aggacgagga aagcaagcgg       960
     ctgcccttcg aagaggccgc aagcggcgcg gtggcgctgg aaacgctgct gcccgcggca      1020
     ctcaggctct atcatgccgg gcagctggat ctgcccaccc tgttccgcgc catggcgctg      1080
     aacccggcgc ggcggctggg gctggcgtcg gggcggctgg gcgcgggcgc gcccgccgat      1140
     ctggtgctgt tcgacccgga tgtgcccttt gtgctggacc ggttcacgct gaaatcgaaa      1200
     tcgcagaaca ccccgtttga cggccagcga atgcaaggta gggtgctggc gacctatgtg      1260
     gccggacagg ccgtttaccg gagagactga                                       1290
//

If you have problems or comments...

PBIL Back to PBIL home page