(data stored in ACNUC7421 zone)

EMBL: CP000031.PE274

CP000031.PE274       Location/Qualifiers
FT   CDS_pept        complement(298273..298659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0285"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0285"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93603"
FT                   /db_xref="GOA:Q5LX77"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX77"
FT                   /protein_id="AAV93603.1"
FT                   /translation="MADPVIRFVADRQAYLRNHTWMAAIAMGGAMAVLWALGNPYIWTG
FT                   APAGLAAIALRGWYLASEELAVVWEISEDTLSGPGPRVPLSQIEIVRTMGSYVQVITKG
FT                   GDKHLIKYQADPAATKAAIERAMT"
     atggctgatc ctgtgatccg ctttgttgca gaccggcagg cctatctgcg caaccacacg        60
     tggatggcgg caatcgccat gggcggcgcc atggcggtgc tctgggcatt gggcaatccc       120
     tatatctgga ccggcgcccc tgcgggtctg gccgcgattg ccctgcgcgg ctggtatctg       180
     gcgtccgagg aactggcggt ggtctgggag atctccgagg acacgctcag cgggcccggc       240
     ccccgcgtgc cgctcagcca gatcgagatt gtgcgcacca tgggcagcta tgtgcaggtg       300
     attaccaagg gcggtgacaa gcacctgatc aagtaccagg cggatccggc cgccaccaag       360
     gccgccatcg aaagggcgat gacatga                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page