(data stored in ACNUC7421 zone)

EMBL: CP000031.PE278

CP000031.PE278       Location/Qualifiers
FT   CDS_pept        301631..302230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0289"
FT                   /product="Ser/Thr protein phosphatase family protein"
FT                   /note="identified by match to protein family HMM PF00149"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0289"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93607"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX73"
FT                   /protein_id="AAV93607.1"
FT                   /translation="MRILAFSDLHMARARAADLVAASLEADLVIGAGDYCNGRQGLDQA
FT                   MAMLAGIMVPLVLVPGNAESADELRAAAPDGAHVLHGSGVRIDGLRLFGLGYGVPPTPF
FT                   GDWSCDLTEGAAAELLDRCTGADILITHSPPKGIGDVTSTGLSVGSTEIRDAIERVQPR
FT                   LALCGHIHDSWGAEGMIGRSRVVNLGPTVNWFEVPA"
     atgcgcattc tggccttttc cgatctgcac atggcgcgcg cccgggccgc cgatctggtc        60
     gccgccagtc ttgaggccga tctggtcatc ggggcgggtg attattgcaa cgggcgtcag       120
     gggctggatc aggcgatggc gatgctggcc gggatcatgg tgccgctggt gctggtaccc       180
     ggcaatgccg aaagtgctga tgaactgcgc gccgccgccc ccgacggcgc ccatgtgctg       240
     catggctctg gcgtgcgcat cgacgggttg cgcctgttcg gtctgggata tggcgtgccg       300
     cccaccccct ttggcgactg gtcctgtgac ctgaccgagg gggcggcggc cgaattgctc       360
     gaccgctgca caggtgccga tatcctgatc acccattcgc cgcccaaggg gatcggcgat       420
     gtgacctcga ccgggctttc ggtcggatca accgaaatcc gcgacgccat cgaacgggtg       480
     cagcccaggc tggcgctgtg cggtcacatt catgacagtt ggggcgccga gggcatgatc       540
     gggcgcagcc gggtcgtcaa tcttggtccc accgtaaact ggttcgaggt gccggcatga       600
//

If you have problems or comments...

PBIL Back to PBIL home page