(data stored in ACNUC7421 zone)

EMBL: CP000031.PE279

CP000031.PE279       Location/Qualifiers
FT   CDS_pept        302227..302847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0290"
FT                   /product="transmembrane amino acid efflux protein"
FT                   /note="identified by match to protein family HMM PF01810"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0290"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93608"
FT                   /db_xref="GOA:Q5LX72"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX72"
FT                   /protein_id="AAV93608.1"
FT                   /translation="MIDPVTLLTFVPAALALNLTPGADMMFCLGQGLRAGPRAGWAASA
FT                   GISAGGMVHVSIAGLGLGAAVQAMPWLFDVIRWVGVAYLLWLAWGALRQEFGTSEAPIR
FT                   PARRAFRDGMLVNLTNPKVILFVLAFIPQFIDPAAGPILAQFLVFGVVIAIGGFIVNGM
FT                   VGQFAGGLGRRLTGDPRLGRVLSRLTAGIFAALALRLALLERT"
     atgatcgacc ctgtcaccct tttgacgttt gttcccgcgg cacttgcgct gaacctgaca        60
     ccgggggccg acatgatgtt ctgcctcggg caggggctgc gcgcgggtcc gcgcgcgggc       120
     tgggccgcca gcgccggtat ctcggcgggc ggcatggtac atgtctcgat cgcgggactg       180
     ggtctgggcg cggcggtgca ggcgatgccc tggctgttcg acgtgatccg ctgggtcggg       240
     gtcgcctatc tgctgtggct ggcctggggc gcgctgcggc aggagttcgg tacctccgag       300
     gcgccgatcc ggcccgcgcg ccgcgccttt cgcgacggga tgctggtcaa cctcaccaat       360
     cccaaggtga tcctgttcgt gcttgccttt atcccgcagt tcatcgaccc ggctgccggg       420
     ccgatcctgg cccagttcct ggtctttggc gtggtgatcg cgattggcgg gttcatcgtc       480
     aacggcatgg tggggcagtt cgccgggggc ttgggccgtc gcctgaccgg cgatccgcgg       540
     cttggccgcg tgctgagccg tcttaccgcc ggaatcttcg ctgcgctggc gctgcggctt       600
     gccctgttag agaggacctg a                                                 621
//

If you have problems or comments...

PBIL Back to PBIL home page