(data stored in ACNUC7421 zone)

EMBL: CP000031.PE28

CP000031.PE28        Location/Qualifiers
FT   CDS_pept        27605..29437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0028"
FT                   /product="ABC transporter, transmembrane ATP-binding
FT                   protein"
FT                   /note="identified by similarity to GB:BAB70471.1; match to
FT                   protein family HMM PF00005; match to protein family HMM
FT                   PF00664"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0028"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93359"
FT                   /db_xref="GOA:Q5LWH3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWH3"
FT                   /protein_id="AAV93359.1"
FT                   /translation="MRFADLIDPFRDTDTPPPQRLGAFIRWALSGAWPVLFVAALFSAL
FT                   AGMFEAITAWILGQVVDRAVELGPEGFFEGTNLATILVAVGFFVLIRPVAFGLSAFSNN
FT                   YIVMPNIPPLVLAKLNRWTLGQSVGFFDDDFAGRIAQKQMQTASALSSVVSETISAIVF
FT                   ALASLIGSLALLGSIHPLVMLPFAVWLCGYFLLIRWYLPRVRKRSAARAGARAMVSGQV
FT                   VDTITNIKTVKLFAHAEAEDVTARNAMADLRERSLDFGWLSASFRFFLMLLAGVLPVIL
FT                   LGSALILWRAGDASAGDVVVAGSVSIRIAQMSGWVSFTLMSLYANLGEVQNGMNSLARA
FT                   ERIEDVADARPLVAGAGKIDFEDVGFAYGRKSGGVDALSLTVAPGEKLGIVGASGAGKS
FT                   TLVSLLLRLYEAENGQIRIDGQDITTVTQDSLRRQIGLVTQETAMFNRSARENILYGRP
FT                   NASEAELIAAAQKAEAHDFILDLADAKGRTGYDAHLGERGVKLSGGQRQRIALARAILK
FT                   DAPILVLDEATSALDSEVEASIQTALHRVMEGKTVLAIAHRLSTLSEMDRIVVLDRGRI
FT                   VESGTHEALLARDGLYARFWHRQSGGFIRTQAAE"
     atgaggtttg ccgacctcat cgacccgttt cgtgacaccg acacgccccc gccccagcgg        60
     ctgggggcgt tcattcgctg ggcattgagc ggcgcctggc cggttctatt cgtcgccgcc       120
     ctgttttctg ccctggcagg catgttcgag gcgattaccg cgtggatact ggggcaggtg       180
     gtcgaccggg cggtcgaact tggtcccgaa gggttttttg agggcaccaa cctggcgaca       240
     atcctggttg cagtgggctt tttcgtgttg atccggccgg ttgcctttgg cctgtcggcc       300
     ttctccaaca actatatcgt catgcccaat atcccgccgc ttgtgctggc caagctgaat       360
     cggtggacgc tgggacaatc ggtgggcttc tttgatgacg atttcgccgg tcggatcgcg       420
     cagaaacaga tgcagacggc aagcgcgctc agctcggtgg tatccgagac catcagcgcg       480
     atcgtctttg cactggcatc gctgatcggc agtttggcct tgttagggtc tattcatcca       540
     ctggtcatgt tgccttttgc ggtgtggctt tgtggctatt ttctgctgat ccgctggtat       600
     ctgccacggg ttcgcaaacg atcggcggcg cgggcgggag cgcgggcgat ggtgtcgggc       660
     caggtagtgg acacgatcac caatatcaag acggtcaagc tgttcgcaca tgccgaggcc       720
     gaggatgtga ccgcgcgcaa tgccatggcc gacctgcgcg agaggtcgct ggatttcggc       780
     tggctttcgg ccagtttccg gttcttcctg atgttgctgg cgggtgtctt gccggtgatc       840
     ctgctgggtt cggcgctgat tctctggcgg gcaggggatg ccagcgcggg cgacgttgtg       900
     gtcgccggat cggtctccat ccgtatcgcg cagatgtccg gttgggtcag tttcacgctg       960
     atgagccttt atgccaacct gggagaggtg cagaacggca tgaacagtct tgcgcgggct      1020
     gaacgtatcg aggatgtcgc ggatgcgcgg cctttggttg cgggcgctgg caagatcgat      1080
     ttcgaggatg tcggctttgc ctatgggcga aaatccggcg gggtcgatgc gttgtcgctg      1140
     accgttgcgc cgggcgaaaa actggggatt gtcggtgcct caggggcggg caagtcgacg      1200
     ctggtttcgt tgctgctcag gctctatgaa gcggaaaacg gacaaatccg cattgacggg      1260
     caggatatca ctaccgtgac gcaggacagt ttgcggcggc agatcgggct ggtgacgcaa      1320
     gagacggcga tgttcaatcg ttcggcccgc gagaacatcc tttatggccg cccaaatgcg      1380
     agcgaggccg agttgatcgc cgccgcgcaa aaggccgagg cgcatgactt catcctggat      1440
     cttgccgacg ccaagggacg caccggatat gacgcccatc tgggcgagcg tggcgtcaag      1500
     ctgagcggtg gtcagcggca gcggattgcg ctggcgcgcg ctatcctcaa agacgcgccg      1560
     atcctggtgc tggacgaggc aaccagcgcg cttgacagcg aggtcgaggc gtcgatccag      1620
     accgcgctgc accgggtgat ggagggcaag accgtgctgg ccatcgcgca ccgtctgtcg      1680
     accctgtcgg aaatggaccg gatcgtggtg ctggatcgcg gccggatcgt cgaaagcggc      1740
     acgcatgaag cgcttttggc gcgcgacggt ctctatgccc ggttctggca tcgtcagtcg      1800
     ggtggcttta ttcgcaccca ggccgccgag taa                                   1833
//

If you have problems or comments...

PBIL Back to PBIL home page