(data stored in ACNUC7421 zone)

EMBL: CP000031.PE280

CP000031.PE280       Location/Qualifiers
FT   CDS_pept        302852..303394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0291"
FT                   /product="molybdenum cofactor biosynthesis protein B"
FT                   /note="identified by similarity to SP:P30746; match to
FT                   protein family HMM PF00994; match to protein family HMM
FT                   TIGR00177"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0291"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93609"
FT                   /db_xref="GOA:Q5LX71"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR012245"
FT                   /db_xref="InterPro:IPR013484"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX71"
FT                   /protein_id="AAV93609.1"
FT                   /translation="MSRIDESLDFIPVRIAVLTVSDTRSIEEDRSGQTLVDRIARAGHL
FT                   LADRRIVRDERAQIADQLRAWVADPEIDVIISTGGTGLTGRDVTVEAHRDVYEKEIEAF
FT                   ATVFTLISMEKIGTSAVQSRATGGVAGGTYLFALPGSPGACKDAWDGILEKQLDYRHRP
FT                   CNFVEIMPRLDEHLRRK"
     ttgtcccgca tcgacgaaag cctcgatttc attccggtcc gcatcgcggt gctcaccgta        60
     tccgataccc gctcgatcga ggaggaccgt tcgggccaga cgctggtcga ccggatcgcg       120
     cgggcgggtc atctgctggc cgaccgccgc atcgttcgcg acgagcgcgc ccagatcgcc       180
     gatcagctgc gggcctgggt tgcagatcca gagatcgacg tgatcatctc gaccggcggc       240
     accggcctga ccgggcgcga tgtgacggtc gaggcccatc gcgatgttta tgaaaaagag       300
     atcgaggcct ttgccaccgt ctttaccctg atctcgatgg aaaagatcgg cacctcggcg       360
     gtgcagtcgc gcgcgacggg gggtgtggcg gggggcacct atctgtttgc actgcccggc       420
     agccccggcg cctgcaagga tgcctgggat ggaatcctgg aaaaacagct cgattatcgg       480
     caccggccct gcaatttcgt ggaaataatg cccagattgg acgaacatct gcgacggaaa       540
     tag                                                                     543
//

If you have problems or comments...

PBIL Back to PBIL home page