(data stored in ACNUC7421 zone)

EMBL: CP000031.PE281

CP000031.PE281       Location/Qualifiers
FT   CDS_pept        303491..304948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0292"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="identified by match to protein family HMM TIGR01730"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0292"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93610"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX70"
FT                   /protein_id="AAV93610.1"
FT                   /translation="MRFLRQSLLGVFLASVALALLIWAGQLVIEAVQARMAGDRKPPAA
FT                   RERVFAVNVQRAEYGTVTPVLEAFGQIQSRRTLELRAAMGGRVIDLSDNFVEGGTVAMG
FT                   EVLVRIDPAKPQTELDRARSDLMDAEAEERDAARALILAGDELQAAADQSALRAQAMKR
FT                   QQNLVERGVGSAAAAETAELADAQARQAVLARRIAVAQAEARVDQAATRLARAQLALEQ
FT                   AERDLTETEVTARFDGTLSGVTLVEGRLVAVNEKLAELVDARALEVVFRVSTAQHTRLL
FT                   DAAGRLIGAPVEIELDVAGADLTATGTISRDSAAAGEGQSGRVIYARLDAAPGFKPGDF
FT                   VTVRVEEPPLADVVRLPASALDAAGTVLVLDSEDRLEQLPVTLIRRQGDAVLIRGEGLA
FT                   GREVVLGRTPLLGPGIRVRPLRDEAQAGSPDLSMLELSDERRARLVALVEANERMPSEV
FT                   KAKVLGQLAETRVPARLVARLEDRAGG"
     atgcgatttc tgcggcagag ccttttgggc gtctttctgg cctcggtggc gcttgccctg        60
     ctgatctggg ccggtcagct ggtgatagag gcggtacagg ccaggatggc cggtgaccgc       120
     aagccgccgg ccgcgcgtga acgggtcttt gccgtcaatg ttcaacgcgc cgaatacggt       180
     accgtcaccc cggttctcga agccttcggt cagatccaaa gtcggcgcac gctggaactg       240
     cgcgccgcga tgggcgggcg cgtgatcgac ctgtcggaca atttcgtcga gggcggcacg       300
     gtcgcgatgg gcgaggtgct ggtgcgcatc gacccggcca agccgcagac cgaactggac       360
     cgcgcgcgat ccgacctgat ggatgccgag gccgaggaac gcgatgccgc aagggcgctg       420
     atcctggccg gtgacgagtt gcaggccgcc gcggatcagt cggccttgcg agcccaggcg       480
     atgaagcggc agcagaacct tgtcgaacgc ggtgtcggca gcgccgccgc cgccgagacc       540
     gccgaactgg ccgatgccca ggcccgtcag gcggtgctgg cgcggcgcat cgcggtggcc       600
     caggccgaag cgcgcgtgga tcaggccgcg acccgtctgg cccgtgctca actggcgctg       660
     gaacaggccg aacgcgatct gactgagacc gaggtgaccg cccggttcga cggcacgctc       720
     agcggtgtca ccctggtcga ggggcggctg gtggcggtga acgagaaact ggcggaactg       780
     gtcgatgccc gcgcgcttga ggtggtgttc cgcgtctcga ccgcccagca tacgcggctg       840
     ttggatgcgg cgggccggct gatcggcgcg ccggtcgaaa tcgaactgga tgtggccggg       900
     gccgatctga ccgccaccgg caccatcagc cgcgacagcg cggcggcggg cgaggggcag       960
     tcgggccggg tcatctatgc ccgcctcgat gcggctccgg gattcaagcc cggtgatttc      1020
     gtgaccgtcc gggtcgagga accgccgctg gccgatgtgg tccgcctgcc ggcatcggcg      1080
     ctggacgcag ccggcacggt actggttctg gacagtgagg accggctgga gcaattgccg      1140
     gtcaccctga tccggcggca gggtgacgcg gtcctgatcc ggggcgaggg gctggccggg      1200
     cgcgaggtgg tgctgggccg cacgccgctc ttgggccccg gcatccgggt ccgccccctg      1260
     cgggacgagg cgcaggcggg cagtcccgat ctgtcgatgc tggagctgag tgacgaacgc      1320
     cgcgcccggc tggtggcgtt ggtcgaggcc aatgagcgga tgccctccga agtcaaggcc      1380
     aaggtgctgg gccagctcgc cgaaacccgc gttcccgcca ggctggtggc ccggctggaa      1440
     gaccgggccg ggggctga                                                    1458
//

If you have problems or comments...

PBIL Back to PBIL home page