(data stored in ACNUC7421 zone)

EMBL: CP000031.PE283

CP000031.PE283       Location/Qualifiers
FT   CDS_pept        complement(308364..308783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0294"
FT                   /product="hydrolase, NUDIX family"
FT                   /note="identified by match to protein family HMM PF00293"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0294"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93612"
FT                   /db_xref="GOA:Q5LX86"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX86"
FT                   /protein_id="AAV93612.1"
FT                   /translation="MTAQPRIGALAVVIHEGQVLLAQRGKDPGRGLWGFPGGHVEWGET
FT                   VRDAALRELHEETAIEARAQRYLTHFDLIHRDDAGQAVVHYLLVGVLCRYQAGAPQAGD
FT                   DAMDARWFPIDHVREGTVPLIDRVSELMEIALSAS"
     gtgacggcgc agcccaggat cggagcattg gccgtggtga tccacgaagg ccaagtcttg        60
     ctggcacagc gcggcaagga tcccgggcgc gggctttggg gctttcccgg cggccatgtg       120
     gaatggggcg agacggtgcg tgacgccgcc ctgcgggaac tgcacgagga aaccgcgatc       180
     gaggcccgcg cgcaacgtta tctgacccat ttcgacctga tccaccgcga tgacgccgga       240
     caggcggtgg tgcattacct gctggtcggc gtgctctgcc gctatcaggc gggcgccccg       300
     caggccggcg acgatgccat ggacgcgcgc tggtttccca tcgaccatgt gcgcgaaggc       360
     accgtgccgc tgatcgaccg ggtcagcgag ctgatggaga tcgccctgag cgcgagttaa       420
//

If you have problems or comments...

PBIL Back to PBIL home page