(data stored in ACNUC9435 zone)

EMBL: CP000031.PE284

CP000031.PE284       Location/Qualifiers
FT   CDS_pept        complement(308787..309605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0295"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:BAC46756.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0295"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93613"
FT                   /db_xref="GOA:Q5LX85"
FT                   /db_xref="InterPro:IPR028250"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX85"
FT                   /protein_id="AAV93613.1"
FT                   /translation="MGMSTRFPMLALAALLSLPLAAPAPAAGLDDLVQIEILDGGLTPS
FT                   GTYLGAIRMTLSEGWKTYWRAPGEAGIPPSFDWRGSRNLGELSITWPAPEVFEQSGLRS
FT                   IGYTDQMVLPIEITPKDANRPVRLRGEMEFGVCKDICVPGNLDFDHTLDASAPRNPAIV
FT                   AALARRPYSAAEAGVTSATCRISPSQGGMRIEARIAMPSAGGSELAVFEPGDPALWAGE
FT                   AQTRRQGNTLIASSEILNDGGTAFALDRSRIRITVLGAKRAVDIRGCLPG"
     ttgggcatgt cgacccgctt tcccatgctg gcgcttgccg ccttgctgag cctaccgctt        60
     gccgccccgg cccccgccgc ggggctggac gatctggtgc agattgaaat cctcgatggc       120
     ggtctgaccc ccagcggcac ctatctgggc gccatccgca tgaccctgtc cgaggggtgg       180
     aagacctatt ggcgcgcgcc gggcgaggca ggcattccgc ccagtttcga ctggcgtggc       240
     tcgcgcaacc tgggcgagct gagcatcacc tggcccgcac ccgaagtgtt cgagcagagc       300
     ggcctgcgct cgatcggcta taccgatcag atggtgttgc cgatcgaaat cacccccaag       360
     gatgccaacc gcccggttcg gctgcgtgga gagatggaat tcggcgtctg caaggatatc       420
     tgcgtgcccg gcaatctgga cttcgatcac acgctggacg ccagcgcgcc gcgcaacccg       480
     gccatcgtcg cggccctggc ccggcggccc tattcggcag ccgaggccgg cgtgacctcg       540
     gccacctgcc ggatcagccc cagtcagggc ggcatgcgga tcgaggcgcg gatcgcgatg       600
     ccctcagccg gtggatcgga acttgccgtg ttcgaaccgg gtgatccggc gctctgggcc       660
     ggcgaggcgc agacccggcg tcagggcaat accctgatcg ccagctcgga aatcctcaac       720
     gatggcggca ccgcctttgc gctcgaccgc tcgcgcatcc gcatcaccgt gctgggcgcc       780
     aagcgggcag tggatatccg tggctgtctg ccaggctga                              819
//

If you have problems or comments...

PBIL Back to PBIL home page