(data stored in ACNUC7421 zone)

EMBL: CP000031.PE286

CP000031.PE286       Location/Qualifiers
FT   CDS_pept        complement(310446..311396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0297"
FT                   /product="Sua5/YciO/YrdC family protein"
FT                   /note="identified by match to protein family HMM PF01300;
FT                   match to protein family HMM PF03481; match to protein
FT                   family HMM TIGR00057"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0297"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93615"
FT                   /db_xref="GOA:Q5LX83"
FT                   /db_xref="InterPro:IPR005145"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR010923"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR038385"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX83"
FT                   /protein_id="AAV93615.1"
FT                   /translation="MPVQPTLRLAADPDGIARAAELLRDGRLVAFPTETVYGLGGDATN
FT                   GQAVAGIYAAKGRPSFNPLIAHVASAEAARRHVHWSETAERLATAFWPGPLTLVLPLRA
FT                   NHGISELVTAGLDTLAVRVPAHPTARTLLATLDRPVAAPSANPSGRISPTTADHVLAGL
FT                   DGRIAAVLDAGPCGVGVESTIVGLSGTPILLRPGGLPTEEIEALLGQPLARHQQGDNIS
FT                   APGQLLSHYAPQSTVRLNARAPSDGEVFLGFGPMDCDENLSPSGNLTEAAANLFAALHR
FT                   LDTTGKPIAIAPIPERGLGLAINDRLRRAAAPRDP"
     atgccagtcc aacccaccct tcgccttgcc gccgatcccg acggcatcgc ccgcgcggca        60
     gagctgctgc gggacggccg gcttgtagcc ttcccgaccg agacggtcta tgggctgggt       120
     ggcgatgcca ccaacgggca ggcggtggcc ggcatctatg ccgccaaggg acgccccagc       180
     ttcaacccgc tgattgccca tgtcgccagc gccgaggcgg cccggcgcca tgtacactgg       240
     tccgaaaccg ccgagcggct cgcaaccgcc ttctggcccg gcccactgac gctggttctg       300
     ccgttgcgcg ccaaccatgg gatatcggaa ctggtcaccg ccgggctcga cacgctggcg       360
     gtgcgggtgc cggcccaccc caccgcgcgc acgctgcttg ccacgctcga ccggccggtc       420
     gccgcccctt cggccaaccc ctcgggccgg atcagcccga ccacggcgga tcatgtgctg       480
     gcaggcctcg atggccggat cgcggcggtg ctcgacgcag gcccctgcgg cgtgggcgtg       540
     gaatcgacca tcgtcggcct gtccggcaca cccatcctgc tgcgccccgg cggcctgccc       600
     accgaagaga tcgaggcgtt gctgggccag cctctggcgc ggcaccaaca gggcgacaac       660
     atcagcgcgc cgggtcagct cctatcgcat tacgcgcccc agagcacagt ccgcctcaac       720
     gcccgcgccc cgtcggatgg cgaagtcttc ctcggcttcg gcccgatgga ttgcgacgaa       780
     aacctctccc cttcgggcaa cctgaccgag gcggcggcca atctctttgc cgcgctgcac       840
     cgactcgaca cgactggcaa acccatcgcg atcgccccga tcccagagcg cgggcttggc       900
     ctagccatca acgatcgcct gcgccgcgct gccgcgccgc gcgatccctg a                951
//

If you have problems or comments...

PBIL Back to PBIL home page