(data stored in ACNUC9435 zone)

EMBL: CP000031.PE287

CP000031.PE287       Location/Qualifiers
FT   CDS_pept        311525..313228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0298"
FT                   /product="acyl-CoA dehydrogenase family protein"
FT                   /note="identified by match to protein family HMM PF00441;
FT                   match to protein family HMM PF02770"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0298"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93616"
FT                   /db_xref="GOA:Q5LX82"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX82"
FT                   /protein_id="AAV93616.1"
FT                   /translation="MPYRSPVTDYTFLLSHVVGYDRVSGTEKYAEAGADMVSAILTEAG
FT                   RMCDEVMAPLQRGGDLNPARLENGALRSSPGFAEGWKAIAEGGWIGMSGSPEHGGMGLP
FT                   MAVTTAVNDMMSGACLSLQLAPLMSQGQIEALEHHASDAIKALYLPKLISGEWSGTMNL
FT                   TEPQAGSDVGALSSKAEPNGDGTYAVTGQKIFISWGDNDFCDNVCHLVLARLPDGVPGT
FT                   KGISLFLVPRNLPDENGNAGVANSLKVVSLEHKMGLHGSPTCVMQYDGATGWLVGEEHG
FT                   GMAAMFTMMNNARLGVGGQGVGVAEAAWQHAMAYAMERKQGKSASGTIADHADVRRMLT
FT                   SMKADVFAARAILAACAVAIDMGNATGSAEWKARAAFLTPIAKAFGTDTGIAVSETGVQ
FT                   VHGGMGFIEETGAAQFYRDVRVTAIYEGTNGIQAMDLVARKMMDGGEAAAKLLDEIEDH
FT                   AERARGRLPELAGPVWEATETLREATEWMVAQGELNDRFAGAVPFLRAFARVLGGHFHL
FT                   IAALADPGGPREKLARYYINALLPEHAGLLEQAQGGCADLYAISLEELSA"
     atgccatacc gttcgcccgt gaccgattat acgttcctgc tgagccatgt ggtgggatat        60
     gaccgggtgt ccgggaccga gaaatatgcc gaggcgggcg ccgatatggt gagtgccatc       120
     ctgaccgagg ccgggcgcat gtgcgacgag gtgatggcgc ccttgcaacg cggcggcgat       180
     ctgaaccctg cgcggctgga aaacggggcg ctgcgcagtt cgcccggctt tgccgagggg       240
     tggaaggcga ttgccgaggg cggctggatc ggcatgagcg ggtcgccgga gcatggcggc       300
     atggggctgc cgatggcggt gaccacggca gtgaacgaca tgatgagcgg tgcctgcctg       360
     tcgctgcagt tggcgccgct gatgagccag ggccagatcg aggcgctgga gcatcatgcc       420
     agcgacgcga tcaaggcgct gtacctgccc aagctgatct cgggcgagtg gtcgggcacc       480
     atgaacctga ccgaaccgca ggccgggtcg gatgtgggcg cgctgagctc caaggccgag       540
     cccaatggcg acggcaccta tgcggtgacc gggcagaaga tcttcatcag ctggggcgac       600
     aacgatttct gcgacaatgt ctgccacctg gtgctggcgc ggctgcccga tggggtgccg       660
     gggaccaagg gcatctcgct gttcctggtg ccgcgaaacc tgccggatga gaatggcaat       720
     gcgggcgtgg ccaacagcct caaggtggtg tcgctggagc acaagatggg cctgcacggc       780
     tctcccacct gcgtgatgca gtatgacggc gccaccggct ggctggtggg cgaggaacat       840
     ggcggcatgg cggccatgtt caccatgatg aacaacgccc gccttggcgt gggcgggcag       900
     ggtgtcggcg tggccgaggc ggcctggcag cacgcgatgg cctatgcgat ggagcgcaag       960
     cagggcaaat ccgcctcagg caccattgcc gaccatgcgg atgtgcgccg gatgctgacc      1020
     agcatgaagg ccgatgtatt cgccgcccgt gcgatcctgg cggcctgtgc cgtggcgatc      1080
     gacatgggta atgcgaccgg atcggccgag tggaaggcgc gggcggcttt cctgaccccg      1140
     attgccaagg cgttcggcac cgataccggt atcgcggtct cggaaaccgg ggtgcaggtg      1200
     catggcggca tgggctttat cgaggaaacc ggcgcagcgc agttctatcg cgatgtgcgg      1260
     gtgaccgcga tctacgaggg caccaacggc attcaggcga tggatctggt tgcccgcaag      1320
     atgatggatg gcggcgaggc tgcggccaag ctgctggacg agatcgagga tcatgccgag      1380
     cgcgcccgtg gtcgcctgcc ggaactggcc ggacccgtct gggaggccac cgagaccctg      1440
     cgcgaggcca ccgaatggat ggtggcacaa ggagagctga acgaccgctt tgccggggcg      1500
     gtgccattcc tgcgcgcctt tgcccgggtg ctgggtggcc atttccacct gatcgcggcc      1560
     ctggccgatc ccggtggtcc gcgcgagaaa ctggcgcggt attacatcaa cgcgctgttg      1620
     cccgaacatg ccggcctgct ggaacaggcg cagggcggtt gtgccgacct ttatgccatc      1680
     agccttgaag agttgtcggc gtga                                             1704
//

If you have problems or comments...

PBIL Back to PBIL home page