(data stored in ACNUC9435 zone)

EMBL: CP000031.PE288

CP000031.PE288       Location/Qualifiers
FT   CDS_pept        313225..314274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0299"
FT                   /product="metallo-beta-lactamase family protein"
FT                   /note="identified by match to protein family HMM PF00753"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0299"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93617"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX81"
FT                   /protein_id="AAV93617.1"
FT                   /translation="MMDRTPGLAMRYPWDEPPAHGSAIEVAEGVLWMRLPLPMKLDHVN
FT                   VYALDDGDGWTVIDTGFSSKKTRAIWQALIDGPLAGKPVRRVVVTHHHPDHMGNAGWFQ
FT                   SELGAELVTTRTAWLFSRMLTLDVQESWPEETLDYYRSAGMAPEVLAKRMAERPFNFAD
FT                   MVYPMPLGFARIKQGDVFRMGGRDWDVHMGNGHAPEHATFWSRDDNLVITGDQILSSIS
FT                   PNIGVYATEPMADPLADWLETCERLAPLARPEHLALGGHKLPFTGLPIRMRQLIDNHHG
FT                   ALKRLRDHLDTPKAASDCFAPLFKRTIGEGEYGLALVEAVAHVNHLYHTGEVTRTRRAD
FT                   GAWLYQRKG"
     gtgatggatc ggacaccggg cctggccatg cgctacccct gggacgagcc gcccgcccat        60
     ggttctgcga tcgaagtggc cgagggcgtg ttgtggatgc gcctgccgct gccgatgaag       120
     ctggatcatg tcaatgtcta tgctttggac gatggcgatg gctggacggt gatcgacacc       180
     gggttttcgt cgaaaaagac gcgggcgatc tggcaggcgc tgatcgacgg gccgctggcg       240
     ggcaagcctg tgcgccgggt ggtcgtgacc catcaccacc ccgaccatat gggcaatgcc       300
     ggctggttcc agtctgaact gggtgccgag ctggtcacca cacgcaccgc atggctgttc       360
     tcgcgcatgc tgacactgga cgtgcaggaa agctggcccg aggaaacgct cgactattac       420
     cgcagcgcgg gcatggcgcc cgaggtgctg gcaaagcgga tggccgagcg gccgttcaac       480
     tttgccgata tggtctatcc gatgccattg ggctttgccc ggatcaagca gggcgacgtg       540
     ttccgcatgg gcgggcgcga ctgggacgtg catatgggca acggccacgc gcccgaacac       600
     gcgaccttct ggagccgcga tgacaatctg gtgatcaccg gcgatcagat cctcagctcg       660
     atcagcccca atatcggagt ctatgcgacc gagccgatgg ccgacccgct ggccgactgg       720
     ctggaaacct gcgaacggct ggcgccgctg gcccggcccg agcatctggc actgggcggg       780
     cacaagctgc cctttaccgg cctgccgatc cggatgcggc agctgatcga caaccaccat       840
     ggcgcgctga agcgtctgcg cgaccacctc gatacgccga aagcggcctc ggactgtttt       900
     gcgccgctgt tcaagcgcac catcggcgag ggcgaatacg ggctggcgct ggttgaagcg       960
     gttgcccatg tcaaccatct ctatcatacc ggagaggtga cacggacccg gcgcgcggat      1020
     ggcgcctggc tctatcagcg gaaaggatga                                       1050
//

If you have problems or comments...

PBIL Back to PBIL home page