(data stored in ACNUC7421 zone)

EMBL: CP000031.PE289

CP000031.PE289       Location/Qualifiers
FT   CDS_pept        314278..314733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0300"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0300"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93618"
FT                   /db_xref="GOA:Q5LX80"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX80"
FT                   /protein_id="AAV93618.1"
FT                   /translation="MQNKIETSAEYAEAAALPPRCHEVHADPDSPARMTDVPVPMQQPV
FT                   QNKSPAQWAYERLILYIRNFEEQLDASQEVAMGFVGGDAGVLRIEGIGFFDPDIVTFYG
FT                   ADGTGARTQLVQHVSQLNVMLRAMPVATEDRPAQRIGFRLAADLEAD"
     atgcagaaca agatcgagac ctcggccgaa tatgccgagg cggcagcgtt gccgccccgt        60
     tgccacgagg tacatgccga tcccgacagc cccgcccgca tgaccgatgt gcccgtgccg       120
     atgcagcagc cggtccagaa caaaagcccg gcgcaatggg cctatgaacg tctgatcctc       180
     tacatccgca acttcgaaga acagctcgac gccagccagg aggtggcgat gggctttgtc       240
     ggcggcgatg ccggggtgtt gcggatcgag gggatcgggt ttttcgatcc cgatatcgtc       300
     acgttttacg gggccgatgg caccggggcg cggacccagc tggttcagca tgtgagccag       360
     ctgaacgtca tgttgcgcgc catgccggtt gcaaccgagg accggccggc ccagcgcatc       420
     ggctttcgtc tggcggcgga tctcgaggcg gactag                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page