(data stored in ACNUC7421 zone)

EMBL: CP000031.PE291

CP000031.PE291       Location/Qualifiers
FT   CDS_pept        316617..317195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0302"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:CAE78911.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0302"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93620"
FT                   /db_xref="GOA:Q5LX96"
FT                   /db_xref="InterPro:IPR036444"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX96"
FT                   /protein_id="AAV93620.1"
FT                   /translation="MQRPIAMTARNLLILCLCAGSPAMAQDLTQMLEMPAHRALMAAQQ
FT                   AAPLTPFTTDGCSGGLSAGWTMVGDTFPDFAAAQGNLPPWEACCVIHDRAYHDAGGALT
FT                   PEDSYAARQQADRALQSCVRDTGESHLADLAVRYDTTPEKVRSAYGTIADAMYLAVRFG
FT                   GGPCSGLPWRWGYGYAHCTPFDSTAPARD"
     atgcaaaggc ctatcgcgat gacagcccgt aacctgctga tcctgtgcct ttgcgccgga        60
     agtccggcga tggcgcagga tctgactcag atgctcgaaa tgccggcgca ccgcgcgctg       120
     atggcggcgc aacaggcggc accgctgacc ccctttacca ccgatggctg ttcgggcggg       180
     ctcagcgccg gttggaccat ggttggcgac acctttcccg atttcgccgc cgcgcaaggc       240
     aacctgccac catgggaggc ctgctgcgtc atccatgacc gcgcctatca cgatgcgggc       300
     ggagcgctga cccccgagga cagctatgcc gcgcgccagc aggcggatcg cgccttgcaa       360
     agctgtgtgc gcgacaccgg agaaagccat ctggcggatc tggcggtgcg ttatgacacc       420
     acgcccgaaa aagtgcgctc tgcctatggc accatcgccg atgcgatgta tctggcggtg       480
     cgctttggcg gcggtccctg ctctggtctg ccgtggcgat ggggctatgg atatgcccac       540
     tgcacccctt tcgactctac cgcgcctgcg cgcgattga                              579
//

If you have problems or comments...

PBIL Back to PBIL home page