(data stored in ACNUC7421 zone)

EMBL: CP000031.PE300

CP000031.PE300       Location/Qualifiers
FT   CDS_pept        complement(323819..324826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0311"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0311"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93629"
FT                   /db_xref="GOA:Q5LXA5"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXA5"
FT                   /protein_id="AAV93629.1"
FT                   /translation="MSGPSPDPDPARNTPLGLYDRPRRASVTGIEIIAIALTLLWLAVS
FT                   VYLFAFADAGAGGGIGFLVTMLAIFMPVAMIWVAATAAKASRVMREESQRLQAAIDAIR
FT                   QAYISQQQKQAAGHEPSVAKKLDEIAAAAKKTETTLATFSTSRRARALPMPAAAPESAE
FT                   DQGLLALGTPAEALSPPLSTEDLIRALHFPETAEDVEGFAALRRALKDRSAAQLIQAAQ
FT                   DVLTLLSHEGIYMDDLRPDMARPEVWRQFAHGARGRTVASLGGVRDRSSLALTAGRMKQ
FT                   DPIFRDAAHHFLRLFDRMFTTFEAQASDAEISALGETRTARAFMLLGRVAGTFD"
     atgtccggcc cgtcgcctga cccagacccc gcccgcaaca caccgcttgg gctttatgac        60
     cggccccggc gcgcttcggt gaccgggatc gaaatcattg ccatcgctct gaccctgctg       120
     tggctggcgg tgtcggtcta tctgttcgcc tttgccgatg ccggcgctgg cggggggatc       180
     ggatttctgg tgaccatgct cgcgatcttc atgccggtgg caatgatctg ggtggcggcc       240
     acggctgcca aggcgagccg ggtcatgcgc gaggaaagcc agcgcctgca agcggcgatc       300
     gacgcgatcc gccaggccta tatcagccag caacagaaac aggccgcagg gcacgaaccc       360
     tcggtcgcca agaagctgga cgaaatcgcc gccgccgcca agaagaccga aaccactctg       420
     gccaccttct cgacctcgcg gcgggcgcgt gccctgccca tgcccgctgc cgcaccggaa       480
     agcgccgagg atcaggggct gttggcgctt ggcaccccgg ccgaggcgct gtcgccgccg       540
     ctctcgaccg aggacctgat ccgcgccctg catttcccgg aaaccgccga ggatgtcgaa       600
     ggcttcgccg cgctgcgccg cgcactcaag gaccgctcgg cagcgcaact gatccaggcc       660
     gcgcaggatg tgctgaccct gctcagccat gaaggcatct atatggacga cctgcgccca       720
     gacatggccc ggcccgaggt gtggcggcag tttgcccatg gggcgcgtgg gcgaacggtg       780
     gcgtcattgg gcggcgtgcg cgaccgctcg tcactggcgc tgaccgcagg ccggatgaag       840
     caggacccga tctttcgcga tgcggcgcat catttcctgc gcctgttcga ccggatgttc       900
     accacgttcg aggctcaggc cagcgatgcc gagatctcgg ccctgggcga gacgcgcacc       960
     gctcgcgcct tcatgctgct gggccgggtg gcgggcacct tcgactaa                   1008
//

If you have problems or comments...

PBIL Back to PBIL home page