(data stored in ACNUC9435 zone)

EMBL: CP000031.PE302

CP000031.PE302       Location/Qualifiers
FT   CDS_pept        complement(325446..325826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0313"
FT                   /product="glyoxalase family protein"
FT                   /note="identified by match to protein family HMM PF00903"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0313"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93631"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXA3"
FT                   /protein_id="AAV93631.1"
FT                   /translation="MKATLEHANLTVADPKATAAWLNTVFGWETRWEGAAIAGGYTVHV
FT                   GDAGTYLALYAPPKPVPSAETSYDVIGGLNHVGVVVDDIDATEERVRAAGFTPHNHADY
FT                   EPGRRFYFDDDNGIEFEVVSYP"
     atgaaagcca ccctggaaca cgcaaacctt accgtcgccg atcccaaggc gaccgccgca        60
     tggctgaaca cggtgttcgg ctgggaaacc cgctgggagg gcgccgcgat cgcgggcggc       120
     tataccgtgc acgtgggtga tgccggcacc tatctggcgc tttacgcccc gcccaagccg       180
     gtcccctcgg ccgagaccag ctatgacgtg atcggcgggc tgaaccatgt aggcgtcgtg       240
     gtcgacgata tcgacgcgac cgaggaacgg gtgcgcgcgg ccggctttac cccgcataac       300
     catgccgatt acgaacccgg gcgccggttc tatttcgacg atgacaacgg catcgaattc       360
     gaggtcgtca gctaccccta a                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page